CD35 Antibody


Western Blot: CD35 Antibody [NBP2-13872] - Analysis in human tonsil tissue.
Immunohistochemistry-Paraffin: CD35 Antibody [NBP2-13872] - Staining of human tonsil shows distinct reticular positivity in germinal center.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

CD35 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: VKCQALNKWEPELPSCSRVCQPPPDVLHAERTQRDKDNFSPGQEVFYSCE PGYDLRG
Specificity of human CD35 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CD35 Protein (NBP2-13872PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CD35 Antibody

  • C3BR
  • CD35
  • complement component (3b/4b) receptor 1 (Knops blood group)
  • CR1
  • KN


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Single Cell Western
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Hu
Applications: WB, Flow, AdBlk, CyTOF-ready, ICC
Species: Hu
Applications: B/N, Flow, IHC, IHC-P, IP, CyTOF-ready
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu
Applications: WB, ELISA, Flow, IHC-P, IP
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
Species: Hu
Applications: Flow, CyTOF-ready
Species: Mu
Applications: B/N, Flow, IHC-Fr, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P

Publications for CD35 Antibody (NBP2-13872) (0)

There are no publications for CD35 Antibody (NBP2-13872).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD35 Antibody (NBP2-13872) (0)

There are no reviews for CD35 Antibody (NBP2-13872). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD35 Antibody (NBP2-13872) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CD35 Products

Bioinformatics Tool for CD35 Antibody (NBP2-13872)

Discover related pathways, diseases and genes to CD35 Antibody (NBP2-13872). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD35 Antibody (NBP2-13872)

Discover more about diseases related to CD35 Antibody (NBP2-13872).

Pathways for CD35 Antibody (NBP2-13872)

View related products by pathway.

PTMs for CD35 Antibody (NBP2-13872)

Learn more about PTMs related to CD35 Antibody (NBP2-13872).

Blogs on CD35

There are no specific blogs for CD35, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CD35 Antibody and receive a gift card or discount.


Gene Symbol CR1