CD30/TNFRSF8 Antibody - BSA Free

Immunohistochemistry: CD30/TNFRSF8 Antibody [NBP2-38201] - Staining of human testis shows strong cytoplasmic positivity in a subset of cells in seminiferus ducts.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CD30/TNFRSF8 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CD30/TNFRSF8 Antibody - BSA Free (NBP2-38201) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: DTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TNFRSF8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CD30/TNFRSF8 Protein (NBP2-38201PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CD30/TNFRSF8 Antibody - BSA Free

• CD30 antigen
• CD30
• CD30KI-1
• CD30L receptor
• cytokine receptor CD30
• D1S166EKi-1
• Ki-1 antigen
• Lymphocyte activation antigen CD30
• TNFRSF8
• tumor necrosis factor receptor superfamily member 8
• tumor necrosis factor receptor superfamily, member 8

Background

CD30 is a type I transmembrane protein and a member of the tumor necrosis factor receptor superfamily of proteins. (1,2) Murine CD30 is expressed predominantly in the thymus, and it is inducible in mouse splenocytes stimulated with pokeweed mitogen or concanavalin A. (1) In anti-CD3epsilon-activated spleen cells, CD30 is expressed primarily on the surface of CD8+ T cells with peak expression on days 4 and 5. Stimulation of CD30+ CTL lines with plate-bound anti-CD30 directly signals IL-5 but not IFN; production. (1) While these studies demonstrate that CD30 directs cytokine secretion and suggest that CD30 may play a pivotal role in the pattern of cytokine production by T cells, the precise roles of CD30 and its ligand (CD153) in T-cell development have not been clearly defined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TNFRSF8