CD3 zeta Recombinant Protein Antigen

Images

 
There are currently no images for CD3 zeta Protein (NBP1-85750PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CD3 zeta Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD247.

Source: E. coli

Amino Acid Sequence: KFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CD247
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85750.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
30 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CD3 zeta Recombinant Protein Antigen

  • CD247 antigen
  • CD247 antigen, zeta subunit
  • CD247 molecule
  • CD247
  • CD3 zeta
  • CD3H
  • CD3Q
  • CD3z antigen, zeta polypeptide (TiT3 complex)
  • CD3Z
  • CD3ZT-cell receptor T3 zeta chain
  • IMD25
  • T3Z
  • T-cell antigen receptor complex, zeta subunit of CD3
  • T-cell surface glycoprotein CD3 zeta chain
  • TCR Zeta Chain
  • TCRZCD3-ZETA

Background

CD3 (Cluster of Differentiation 3) is a complex of proteins that associates directly with the T cell antigen receptor (TCR). Antigen binding to the TCR leads to IL-2 secretion via activation of a tyrosine phosphorylation pathway and a phospholipase C (PLC) pathway, in turn activating protein kinase C. CD3 is composed of five invariant polypeptide chains that associate to form three dimers. The five invariant chains of CD3 are labeled gamma, delta, epsilon, zeta, and eta. The zeta chain plays an important role in coupling antigen recognition to several intracellular signal-transduction pathways. Loss of the zeta chain results in the synthesis of unstable TCRs. A decrease of CD3 zeta has been described in T cells from patients with cancer, lupus and chronic infectious diseases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4841
Species: Mu
Applications: CompCytotox, CyTOF-ready, Flow, ICC, IHC, IP, Tstim
202-IL
Species: Hu
Applications: BA
AF3709
Species: Hu
Applications: IHC, Simple Western, WB
MAB7500
Species: Hu
Applications: ICC, WB
NBP1-49045
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
7268-CT
Species: Hu
Applications: BA
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
485-MI
Species: Mu
Applications: BA
NBP1-82685
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
MAB342
Species: Hu
Applications: AgAct, ICC, WB
4325-FC
Species: Hu
Applications: Bind
NBP2-32636
Species: Hu
Applications: IHC,  IHC-P, Simple Western, WB
1597-FC/CF
Species: Hu
Applications: Bind
DFL00B
Species: Hu
Applications: ELISA
NBP1-84084
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB139
Species: Hu
Applications: CostimT, CyTOF-ready, Flow, Neut, WB
NBP2-46218
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-85750PEP
Species: Hu
Applications: AC

Publications for CD3 zeta Protein (NBP1-85750PEP) (0)

There are no publications for CD3 zeta Protein (NBP1-85750PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD3 zeta Protein (NBP1-85750PEP) (0)

There are no reviews for CD3 zeta Protein (NBP1-85750PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CD3 zeta Protein (NBP1-85750PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CD3 zeta Products

Research Areas for CD3 zeta Protein (NBP1-85750PEP)

Find related products by research area.

Blogs on CD3 zeta

There are no specific blogs for CD3 zeta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CD3 zeta Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CD247