CD3 epsilon Recombinant Protein Antigen

Images

 
There are currently no images for CD3 epsilon Recombinant Protein Antigen (NBP2-38520PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CD3 epsilon Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD3E.

Source: E. coli

Amino Acid Sequence: WSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CD3E
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38520.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CD3 epsilon Recombinant Protein Antigen

  • CD3 epsilon
  • CD3e antigen
  • CD3e antigen, epsilon polypeptide (TiT3 complex)
  • CD3e molecule, epsilon (CD3-TCR complex)
  • CD3e
  • CD3-epsilon
  • FLJ18683
  • T3E
  • T-cell antigen receptor complex, epsilon subunit of T3
  • T-cell surface antigen T3/Leu-4 epsilon chain
  • T-cell surface glycoprotein CD3 epsilon chain
  • TCRE

Background

CD3 epsilon is a subunit of CD3. T cell activation through the antigen receptor (TCR) involves the cytoplasmic tails of the CD3 subunits: CD3 gamma, CD3 delta, CD3 epsilon and CD3 zeta. These CD3 subunits are structurally related members of the immunoglobulins super family encoded by closely linked genes on human chromosome 11. The CD3 components have long cytoplasmic tails that associate with cytoplasmic signal transduction molecules. This association is mediated at least in part by a double tyrosine based motif present in a single copy in the CD3 subunits. CD3 may play a role in TCR induced growth arrest, cell survival and proliferation. The CD3 antigen is present on 68-82% of normal peripheral blood lymphocytes, 65-85% of thymocytes and Purkinje cells in the cerebellum. It is never expressed on B or NK cells. Decreased percentages of T lymphocytes may be observed in some autoimmune diseases.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB4841
Species: Mu
Applications: CompCytotox, CyTOF-ready, Flow, ICC, IHC, IP, Tstim
202-IL
Species: Hu
Applications: BA
NBP1-49045
Species: Mu
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, InhibTFunc
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
MAB7297
Species: Mu
Applications: CyTOF-reported, Flow
7268-CT
Species: Hu
Applications: BA
NBP2-32636
Species: Hu
Applications: IHC,  IHC-P, Simple Western, WB
AF3709
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-76399
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, mIF, Simple Western, WB
MAB7500
Species: Hu
Applications: ICC, WB
485-MI
Species: Mu
Applications: BA
AF114
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
AF2408
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, KO, Simple Western, WB
NB100-65265
Species: Hu, Mu(-), Rt(-)
Applications: IHC, IHC-Fr, IP
NBP2-27104
Species: Hu, Mu, Pm
Applications: IHC,  IHC-P, WB

Publications for CD3 epsilon Recombinant Protein Antigen (NBP2-38520PEP) (0)

There are no publications for CD3 epsilon Recombinant Protein Antigen (NBP2-38520PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD3 epsilon Recombinant Protein Antigen (NBP2-38520PEP) (0)

There are no reviews for CD3 epsilon Recombinant Protein Antigen (NBP2-38520PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CD3 epsilon Recombinant Protein Antigen (NBP2-38520PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CD3 epsilon Products

Research Areas for CD3 epsilon Recombinant Protein Antigen (NBP2-38520PEP)

Find related products by research area.

Blogs on CD3 epsilon

There are no specific blogs for CD3 epsilon, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CD3 epsilon Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CD3E