CD3 epsilon Recombinant Protein Antigen

Images

 
There are currently no images for CD3 epsilon Protein (NBP2-38520PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CD3 epsilon Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD3E.

Source: E.coli

Amino Acid Sequence: WSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CD3E
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-38520.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for CD3 epsilon Recombinant Protein Antigen

  • CD3 epsilon
  • CD3e antigen
  • CD3e antigen, epsilon polypeptide (TiT3 complex)
  • CD3e molecule, epsilon (CD3-TCR complex)
  • CD3e
  • CD3-epsilon
  • FLJ18683
  • T3E
  • T-cell antigen receptor complex, epsilon subunit of T3
  • T-cell surface antigen T3/Leu-4 epsilon chain
  • T-cell surface glycoprotein CD3 epsilon chain
  • TCRE

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-67882
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-32636
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NB110-60490
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-84550
Species: Hu
Applications: WB, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
MAB4841
Species: Mu
Applications: Flow, IHC, IP, CompCytotox, CyTOF-ready, ICC, Tstim
MAB7500
Species: Hu
Applications: WB, ICC
NB100-77417
Species: Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE, Flow-CS
NBP1-45883
Species: Hu, Mu, Rt
Applications: WB, IHC, IP
NBP2-27104
Species: Hu, Mu, Pm
Applications: WB, IHC-P

Publications for CD3 epsilon Protein (NBP2-38520PEP) (0)

There are no publications for CD3 epsilon Protein (NBP2-38520PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD3 epsilon Protein (NBP2-38520PEP) (0)

There are no reviews for CD3 epsilon Protein (NBP2-38520PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for CD3 epsilon Protein (NBP2-38520PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for CD3 epsilon Protein (NBP2-38520PEP)

Discover related pathways, diseases and genes to CD3 epsilon Protein (NBP2-38520PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD3 epsilon Protein (NBP2-38520PEP)

Discover more about diseases related to CD3 epsilon Protein (NBP2-38520PEP).
 

Pathways for CD3 epsilon Protein (NBP2-38520PEP)

View related products by pathway.

PTMs for CD3 epsilon Protein (NBP2-38520PEP)

Learn more about PTMs related to CD3 epsilon Protein (NBP2-38520PEP).
 

Research Areas for CD3 epsilon Protein (NBP2-38520PEP)

Find related products by research area.

Blogs on CD3 epsilon

There are no specific blogs for CD3 epsilon, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CD3 epsilon Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CD3E