CD23/Fc epsilon RII Antibody

Images

 
Western Blot: CD23 Antibody [NBP1-85776] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with ...read more
Immunohistochemistry-Paraffin: CD23 Antibody [NBP1-85776] - Staining of human lymph node shows strong cytoplasmic positivity in reaction center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CD23/Fc epsilon RII Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FCER2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CD23/Fc epsilon RII Protein (NBP1-85776PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CD23/Fc epsilon RII Antibody

  • BLAST-2
  • CD23
  • CD23A
  • CD23CD23 antigen
  • CLEC4J
  • CLEC4JC-type lectin domain family 4 member J
  • C-type lectin domain family 4, member J
  • Fc epsilon RII
  • Fc fragment of IgE, low affinity II, receptor for (CD23)
  • FCE2Fc fragment of IgE, low affinity II, receptor for (CD23A)
  • fc-epsilon-RII
  • FCER2
  • Fcer2a
  • FceRII
  • IGEBF
  • Immunoglobulin E-binding factor
  • low affinity immunoglobulin epsilon Fc receptor
  • Ly-42
  • Lymphocyte IgE receptor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-02690
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB4909
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
H00003669-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NBP2-25250
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85776
Species: Hu
Applications: WB, IHC, IHC-P

Publications for CD23/Fc epsilon RII Antibody (NBP1-85776) (0)

There are no publications for CD23/Fc epsilon RII Antibody (NBP1-85776).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD23/Fc epsilon RII Antibody (NBP1-85776) (0)

There are no reviews for CD23/Fc epsilon RII Antibody (NBP1-85776). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD23/Fc epsilon RII Antibody (NBP1-85776) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CD23/Fc epsilon RII Products

Bioinformatics Tool for CD23/Fc epsilon RII Antibody (NBP1-85776)

Discover related pathways, diseases and genes to CD23/Fc epsilon RII Antibody (NBP1-85776). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD23/Fc epsilon RII Antibody (NBP1-85776)

Discover more about diseases related to CD23/Fc epsilon RII Antibody (NBP1-85776).
 

Pathways for CD23/Fc epsilon RII Antibody (NBP1-85776)

View related products by pathway.

Research Areas for CD23/Fc epsilon RII Antibody (NBP1-85776)

Find related products by research area.

Blogs on CD23/Fc epsilon RII

There are no specific blogs for CD23/Fc epsilon RII, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD23/Fc epsilon RII Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FCER2
Entrez