CD1e Antibody

Images

 
Western Blot: CD1e Antibody [NBP2-31691] - Lane 1: Marker (kDa) 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: CD1e Antibody [NBP2-31691] - Staining of human lymph node shows moderate cytoplasmic positivity in subset of non-germinal center cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CD1e Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PWSHGNFSKQELKNLQSLFQLYFHSFIRIVQASAGQFQLEYPFEIQILAGCRMNAPQIFLNMAYQGSDF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CD1E
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CD1e Protein (NBP2-31691PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CD1e Antibody

  • CD1-alpha-3
  • CD1e molecule
  • CD1e
  • CDIEL
  • e polypeptide
  • FLJ17609
  • membrane-associated
  • R2G1
  • thymocyte antigen CD1E

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7446
Species: Hu
Applications: Flow, CyTOF-ready
NBP2-20231
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46198
Species: Hu
Applications: WB, IHC
NBP1-43461
Species: Mu
Applications: Flow, IHC, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
PP-H7223-00
Species: Hu
Applications: WB, IHC, DirELISA
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-46123
Species: Hu
Applications: WB, IHC, IHC-P, IF
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1936
Species: Hu
Applications: WB, IP
AF1034
Species: Mu, Rt
Applications: WB, Simple Western, IHC
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89285
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CD1e Antibody (NBP2-31691) (0)

There are no publications for CD1e Antibody (NBP2-31691).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD1e Antibody (NBP2-31691) (0)

There are no reviews for CD1e Antibody (NBP2-31691). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD1e Antibody (NBP2-31691) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CD1e Products

Bioinformatics Tool for CD1e Antibody (NBP2-31691)

Discover related pathways, diseases and genes to CD1e Antibody (NBP2-31691). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD1e Antibody (NBP2-31691)

Discover more about diseases related to CD1e Antibody (NBP2-31691).
 

Pathways for CD1e Antibody (NBP2-31691)

View related products by pathway.

Blogs on CD1e

There are no specific blogs for CD1e, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD1e Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CD1E
Entrez
Uniprot