CD1d Recombinant Protein Antigen

Images

 
There are currently no images for CD1d Recombinant Protein Antigen (NBP2-57561PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CD1d Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD1d.

Source: E. coli

Amino Acid Sequence: AEVPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPW

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CD1D
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57561.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CD1d Recombinant Protein Antigen

  • antigen-presenting glycoprotein CD1d
  • CD1A
  • CD1d antigen
  • CD1D antigen, d polypeptide
  • CD1d molecule
  • CD1d
  • differentiation antigen CD1-alpha-3
  • HMC class I antigen-like glycoprotein CD1D
  • MGC34622
  • R3
  • R3G1
  • T-cell surface glycoprotein CD1d
  • thymocyte antigen CD1D

Background

CD1d is a 335 amino acid member of the CD1 family of glycoproteins. CD1d is an antigen-presenting protein that binds self and non-self glycolipids and presents them to T-cell receptors on natural killer T-cells. CD1 transmembrane glycoproteins are structurally related to major histocombatibility complex (MHC) proteins and they form dimers with beta-2-microglobulin. They are considered non-classical MHC proteins and CD1d is the only member of group 2 CD1 molecules. Diseases related to CD1d include susceptibility to infections such as tuberculosis and malaria, hypersensitivity reaction type II disease, multiple sclerosis, myocarditis, diabetes mellitus, rheumatoid arthritis, asthma and atherosclerosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7446
Species: Hu
Applications: CyTOF-ready, Flow
NBP2-46123
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB7330
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP1-31661
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-16797
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP3-25643
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-46198
Species: Hu
Applications: IHC, IHC-P, WB
6507-IL/CF
Species: Hu
Applications: BA
NBP1-19371
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
DY417
Species: Mu
Applications: ELISA
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
NB110-59723
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-P, WB
202-IL
Species: Hu
Applications: BA
AF4884
Species: Mu
Applications: WB
291-G1
Species: Hu
Applications: BA
NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-80306
Species: Av, Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-57561PEP
Species: Hu
Applications: AC

Publications for CD1d Recombinant Protein Antigen (NBP2-57561PEP) (0)

There are no publications for CD1d Recombinant Protein Antigen (NBP2-57561PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD1d Recombinant Protein Antigen (NBP2-57561PEP) (0)

There are no reviews for CD1d Recombinant Protein Antigen (NBP2-57561PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CD1d Recombinant Protein Antigen (NBP2-57561PEP). (Showing 1 - 1 of 1 FAQ).

  1. Do you have an antibody for CD1d that works well on formalin fixed paraffin embedded tissue (specifically for liver tissue)?
    • We do have a CD1d antibody that has been verified in paraffin-embedded tissue sections. The catalog number is NBP1-43461.

Additional CD1d Products

Blogs on CD1d

There are no specific blogs for CD1d, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CD1d Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CD1D