CD155/PVR Antibody

Images

 
Orthogonal Strategies: Western Blot: CD155/PVR Antibody [NBP1-88131] - Analysis in human cell lines A-431 and MCF-7 using Anti-PVR antibody. Corresponding PVR RNA-seq data are presented for the same cell lines. ...read more
Immunohistochemistry-Paraffin: CD155/PVR Antibody [NBP1-88131] - Staining of human tonsil shows no positivity in lymphoid cells as expected.
Western Blot: CD155/PVR Antibody [NBP1-88131] - Analysis in control (vector only transfected HEK293T lysate) and pVR over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T ...read more
Orthogonal Strategies: Immunohistochemistry-Paraffin: CD155/PVR Antibody [NBP1-88131] - Analysis in human placenta and tonsil tissues. Corresponding PVR RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CD155/PVR Antibody [NBP1-88131] - Staining of human placenta shows moderate membranous positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: CD155/PVR Antibody [NBP1-88131] - Staining of human prostate shows weak to moderate membranous positivity in glandular cells.
Immunohistochemistry-Paraffin: CD155/PVR Antibody [NBP1-88131] - Staining of human stomach shows moderate membranous positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

CD155/PVR Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: DVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFP
Specificity
Specificity of human CD155/PVR antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PVR
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Positive Control
CD155/PVR Lysate (NBP2-65506)
Control Peptide
CD155/PVR Protein (NBP1-88131PEP)
Publications
Read Publication using
NBP1-88131 in the following applications:

  • IHC
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CD155/PVR Antibody

  • CD155 antigen
  • CD155
  • HVED
  • NECL5
  • Necl-5
  • nectin-like 5
  • Nectin-like protein 5
  • poliovirus receptor
  • PVR
  • PVS
  • PVSFLJ25946
  • Tage4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF6240
Species: Hu
Applications: WB, ELISA, IHC
NBP2-24614
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
NBP2-65899
Species: Hu
NBP1-87343
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-77933
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-36999
Species: Hu, Mu, Rt
Applications: PEP-ELISA
NBP2-65749
Species: Hu
NBP1-85001
Species: Hu
Applications: IHC, IHC-P
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91211
Species: Hu
Applications: IHC, IHC-P
H00005555-P01
Species: Hu
NBP1-56853
Species: Hu
Applications: WB, ICC/IF, IHC
NBP2-01763
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
H00005554-R02
Species: Hu
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-88131
Species: Hu
Applications: WB, IHC, IHC-P

Publications for CD155/PVR Antibody (NBP1-88131)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for CD155/PVR Antibody (NBP1-88131) (0)

There are no reviews for CD155/PVR Antibody (NBP1-88131). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CD155/PVR Antibody (NBP1-88131) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional CD155/PVR Products

Bioinformatics Tool for CD155/PVR Antibody (NBP1-88131)

Discover related pathways, diseases and genes to CD155/PVR Antibody (NBP1-88131). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CD155/PVR Antibody (NBP1-88131)

Discover more about diseases related to CD155/PVR Antibody (NBP1-88131).
 

Pathways for CD155/PVR Antibody (NBP1-88131)

View related products by pathway.

PTMs for CD155/PVR Antibody (NBP1-88131)

Learn more about PTMs related to CD155/PVR Antibody (NBP1-88131).
 

Research Areas for CD155/PVR Antibody (NBP1-88131)

Find related products by research area.

Blogs on CD155/PVR

There are no specific blogs for CD155/PVR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CD155/PVR Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PVR
Entrez