CD151 Recombinant Protein Antigen

Images

 
There are currently no images for CD151 Protein (NBP1-80924PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CD151 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CD151.

Source: E. coli

Amino Acid Sequence: LNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CD151
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-80924.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CD151 Recombinant Protein Antigen

  • CD151 antigen (Raph blood group)
  • CD151 antigenplatelet surface glycoprotein gp27
  • CD151 molecule (Raph blood group)
  • CD151
  • GP27
  • Membrane glycoprotein SFA-1
  • MER2
  • PETA3
  • PETA-3
  • PETA-3SFA-1
  • platelet-endothelial cell tetraspan antigen 3
  • Platelet-endothelial tetraspan antigen 3
  • RAPH
  • SFA1
  • SFA-1
  • tetraspanin-24
  • TSPAN24
  • tspan-24
  • TSPAN24hemidesmosomal tetraspanin CD151

Background

CD151 is essential for the proper assembly of the glomerular and tubular basement membranes in kidney. It interacts with integrins alpha3beta1, alpha5beta1, alpha3beta1 and alpha6beta4, and with CD9 and CD181. It is expressed in a variety of tissues including vascular endothelium and epidermis, platelets, monocytes and also erythroid cells, with a higher level of expression in erythroid precursors than on mature erythrocytes. CD151 is however not expressed by lymphocytes or granulocytes. Defects in CD151 are the cause of nephropathy with pretibial epidermolysis bullosa and deafness.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

7268-CT
Species: Hu
Applications: BA
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, PA, WB
NB500-327
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC,  IHC-P, In vitro, WB
NBP2-42225
Species: Ca, Hu
Applications: B/N, DB, EM, ELISA, Flow-IC, Flow, Func, ICC/IF, IHC-WhMt, IP, In vitro, WB
NB100-65805
Species: Gt, Hu, Mu, Pm, Sh
Applications: CyTOF-ready, DB, ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NBP2-21792
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, IP, WB
AF4467
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
MAB17781
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IP, KO
AF3628
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
BBA10
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, KO, Simple Western, WB
NB500-393
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IHC-Fr, IP, WB
137-PS
Species: Hu
Applications: BA
NBP2-33867
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-91258
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
294-HG
Species: Hu
Applications: BA
NBP1-59438
Species: Hu
Applications: IHC,  IHC-P, WB
AF972
Species: Hu
Applications: ELISA, IHC, KO, Simple Western, WB

Publications for CD151 Protein (NBP1-80924PEP) (0)

There are no publications for CD151 Protein (NBP1-80924PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CD151 Protein (NBP1-80924PEP) (0)

There are no reviews for CD151 Protein (NBP1-80924PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CD151 Protein (NBP1-80924PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CD151 Products

Blogs on CD151

There are no specific blogs for CD151, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CD151 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CD151