CCS/SOD4 Antibody Summary
Immunogen |
CCS (NP_005116.1, 1 a.a. - 274 a.a.) full-length human protein. MASDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTGRQAVLKGMGSGQLQNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL |
Specificity |
CCS - copper chaperone for superoxide dismutase, |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Mouse |
Gene |
CCS |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.4) |
Preservative |
No Preservative |
Purity |
Protein A purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for CCS/SOD4 Antibody
Background
Copper chaperone for superoxide dismutase specifically delivers Cu to copper/zinc superoxide dismutase and may activate copper/zinc superoxide dismutase through direct insertion of the Cu cofactor. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Hu
Applications: CyTOF-ready, Flow, KO
Species: Ca, Hu, Mu, Po, Rt, Xp, Ze
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, Simple Western, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IP, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC-P, IP, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
Species: Hu
Applications: IHC, WB
Species: Hu
Applications: CyTOF-ready, IP, ICFlow, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: WB
Publications for CCS/SOD4 Antibody (H00009973-B01P) (0)
There are no publications for CCS/SOD4 Antibody (H00009973-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CCS/SOD4 Antibody (H00009973-B01P) (0)
There are no reviews for CCS/SOD4 Antibody (H00009973-B01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CCS/SOD4 Antibody (H00009973-B01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CCS/SOD4 Products
Bioinformatics Tool for CCS/SOD4 Antibody (H00009973-B01P)
Discover related pathways, diseases and genes to CCS/SOD4 Antibody (H00009973-B01P). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for CCS/SOD4 Antibody (H00009973-B01P)
Discover more about diseases related to CCS/SOD4 Antibody (H00009973-B01P).
| | Pathways for CCS/SOD4 Antibody (H00009973-B01P)
View related products by pathway.
|
PTMs for CCS/SOD4 Antibody (H00009973-B01P)
Learn more about PTMs related to CCS/SOD4 Antibody (H00009973-B01P).
| | Research Areas for CCS/SOD4 Antibody (H00009973-B01P)
Find related products by research area.
|
Blogs on CCS/SOD4