CCR5 Antibody

Western Blot: CCR5 Antibody [H00001234-D01P] - Analysis of CCR5 expression in rat liver.

Western Blot: CCR5 Antibody [H00001234-D01P] - Western Blot analysis of CCR5 expression in mouse liver.

Western Blot: CCR5 Antibody [H00001234-D01P] - Analysis of CCR5 expression in transfected 293T cell line by CCR5 polyclonal antibody.Lane 1: CCR5 transfected lysate(40.50 KDa).Lane 2: Non-transfected lysate.

Product Discontinued

CCR5 Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: CCR5 (XP_001125981.1, 1 a.a. - 352 a.a.) full-length human protein. MDYQVSSPIYDINYYTSEPCQKINVKQIAARLLPPLYSLVFIFGFVGNMLVILILINCKRLKSMTDIYLLNLAISDLFFLLTVPFWAHYAAAQWDFGNTMCQLLTGLYFIGFFSGIFFIILLTIDRYLAVVHAVFALKARTVTFGVVTSVITWVVAVFASLPGIIFTRSQKEGLHYTCSSHFPYSQYQFWKNFQTLKIVILGLVLPLLVMVICYSGILKTLLRCRNEKKRHRAVRLIFTIMIVYFLFWAPYNIVLLLNTFQEFFGLNNCSSSNRLDQAMQVTETLGMTHCCINPIIYAFVGEKFRNYLLVFFQKHIAKRFCKCCSIFQQEAPERASSVYTRSTGEQEISVGL
• Specificity: CCR5,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CCR5
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: It has been used for ELISA and WB.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CCR5 Antibody

• C-C CKR-5
• C-C motif chemokine receptor 5 A159A
• CCCKR5
• CC-CKR-5FLJ78003
• CCR5
• CCR-5
• CD195 antigen
• CD195
• chemokine (C-C motif) receptor 5
• chemokine receptor CCR5
• chemr13
• CKR5
• CKR-5
• HIV-1 fusion coreceptor
• IDDM22CMKBR5C-C chemokine receptor type 5

Background

This gene encodes a member of the beta chemokine receptor family, which is predicted to be a seven transmembrane protein similar to G protein-coupled receptors. This protein is expressed by T cells and macrophages, and is known to be an important co-receptor for macrophage-tropic virus, including HIV, to enter host cells. Defective alleles of this gene have been associated with the HIV infection resistance. The ligands of this receptor include monocyte chemoattractant protein 2 (MCP-2), macrophage inflammatory protein 1 alpha (MIP-1 alpha), macrophage inflammatory protein 1 beta (MIP-1 beta) and regulated on activation normal T expressed and secreted protein (RANTES). Expression of this gene was also detected in a promyeloblastic cell line, suggesting that this protein may play a role in granulocyte lineage proliferation and differentiation. This gene is located at the chemokine receptor gene cluster region. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CCR5
• Entrez:
  • 1234(Human)
• Uniprot:
  • XP_001125981.1(Human)