CCNY Antibody

Images

 
Western Blot: CCNY Antibody [NBP1-58071] - Human Liver cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CCNY Antibody Summary

Immunogen
Synthetic peptides corresponding to CCNY(cyclin Y) The peptide sequence was selected from the middle region of CCNY. Peptide sequence DENLHPLSKSEVPPDYDKHNPEQKQIYRFVRTLFSAAQLTAECAIVTLVY.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCNY
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CCNY and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CCNY Antibody

  • CBCP1C10orf9cyc-Y
  • CCNX
  • CFP 1
  • CFP1FLJ95513
  • chromosome 10 open reading frame 9
  • Cyclin box protein 1
  • Cyclin fold protein 1
  • cyclin Y
  • cyclin-box carrying protein 1
  • cyclin-X
  • cyclin-Y
  • Cyc-Y

Background

CCNY belongs to the cyclin family, Cyclin Y subfamily. It contains 1 cyclin N-terminal domain. Single nucleotide polymorphism in CCNY gene is associated with Crohn's disease and ulcerative colitis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56630
Species: Hu
Applications: WB
NBP1-92248
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-558
Species: Hu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
NB100-56519
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, IHC-FrFl
NBP1-80920
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13659
Species: Hu
Applications: IHC, IHC-P
NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
MAB1930
Species: Hu, Mu, Rt
Applications: WB
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NB600-1147
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, IHC-P, Flow-CS
NBP1-92249
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37922
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-76377
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
AF1505
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-28684
Species: Hu
Applications: IHC, IHC-P, IP
NBP1-57770
Species: Hu
Applications: WB
NB100-56537
Species: Hu, Mu
Applications: WB, ChIP, IP

Publications for CCNY Antibody (NBP1-58071) (0)

There are no publications for CCNY Antibody (NBP1-58071).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCNY Antibody (NBP1-58071) (0)

There are no reviews for CCNY Antibody (NBP1-58071). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CCNY Antibody (NBP1-58071) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for CCNY Antibody (NBP1-58071)

Discover related pathways, diseases and genes to CCNY Antibody (NBP1-58071). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCNY Antibody (NBP1-58071)

Discover more about diseases related to CCNY Antibody (NBP1-58071).
 

Pathways for CCNY Antibody (NBP1-58071)

View related products by pathway.

PTMs for CCNY Antibody (NBP1-58071)

Learn more about PTMs related to CCNY Antibody (NBP1-58071).
 

Research Areas for CCNY Antibody (NBP1-58071)

Find related products by research area.

Blogs on CCNY

There are no specific blogs for CCNY, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCNY Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCNY
Uniprot