CCL4L2 Antibody (4G8) - Azide and BSA Free

Western Blot: CCL4L2 Antibody (4G8) [H00388372-M01] - Detection against Immunogen (33.26 KDa)

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 4G8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

CCL4L2 Antibody (4G8) - Azide and BSA Free Summary

• Immunogen: CCL4L2 (NP_996890, 28 a.a. ~ 92 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SDPPTACCFSYTARKLPRNFVVDYYETSSLCSQPAVVFQTKRGKQVCADPSESWVQEYVYDLELN
• Specificity: CCL4L2 (4G8)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CCL4L2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CCL4L2 Antibody (4G8) - Azide and BSA Free

• AT744.2
• CC chemokine ligand 4L1
• CC chemokine ligand 4L1d2
• CC chemokine ligand 4L2
• CCL4L
• chemokine (C-C motif) ligand 4-like 1, telomeric
• chemokine (C-C motif) ligand 4-like 2
• LAG1
• LAG-1
• Lymphocyte activation gene 1 protein
• lymphocyte activation gene 1
• Macrophage inflammatory protein 1-beta
• macrophage inflammatory protein-1b2
• MIP-1-beta
• Monocyte adherence-induced protein 5-alpha
• SCYA4L
• SCYA4L1
• SCYA4L2
• Small-inducible cytokine A4-like

Background

This gene is one of several cytokine genes clustered on the q-arm of chromosome 17. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. This protein is similar to CCL4 which inhibits HIV entry by binding to the cellular receptor CCR5. The copy number of this gene varies among individuals; most individuals have 1-5 copies in the diploid genome, although rare individuals do not contain this gene at all. The human genome reference assembly contains two copies of this gene. This record represents the more telomeric gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CCL4L2 Antibody (H00388372-M01)(2)

Publications using H00388372-M01

• Lan J, Zhang Y, Jin C et Al. Gut Dysbiosis Drives Inflammatory Bowel Disease Through the CCL4L2-VSIR Axis in Glycogen Storage Disease Adv Sci (Weinh) 2024-06-18 [PMID: 38889269]
• Tsai CH, Lai AC, Lin YC et al. Neutrophil extracellular trap production and CCL4L2 expression influence corticosteroid response in asthma Science translational medicine 2023-06-07 [PMID: 37285400] (Western Blot, Human, Mouse)

Bioinformatics

• Gene Symbol: CCL4L2
• Entrez:
  • 388372(Human)
• Uniprot:
  • NP_996890(Human)