CCL21/6Ckine Antibody

Western Blot: CCL21/6Ckine Antibody [H00006366-D01P] - Analysis of CCL21 expression in transfected 293T cell line by CCL21 polyclonal antibody.Lane 1: CCL21 transfected lysate(14.60 KDa).Lane 2: Non-transfected lysate.

Product Discontinued

CCL21/6Ckine Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: CCL21 (NP_002980.1, 1 a.a. - 134 a.a.) full-length human protein. MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP
• Specificity: CCL21 - chemokine (C-C motif) ligand 21,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CCL21
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CCL21/6Ckine Antibody

• 6Ckine
• 6CkineSmall-inducible cytokine A21
• Beta-chemokine exodus-2
• CCL21
• chemokine (C-C motif) ligand 21
• CKb9
• exodus-2
• member 21
• SCYA21
• SCYA21MGC34555
• secondary lymphoid tissue chemokine
• SLC
• SLCSecondary lymphoid-tissue chemokine
• TCA-4

Background

This gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. Similar to other chemokines the protein encoded by this gene inhibits hemopoiesis and stimulates chemotaxis. This protein is chemotactic in vitro for thymocytes and activated T cells, but not for B cells, macrophages, or neutrophils. The cytokine encoded by this gene may also play a role in mediating homing of lymphocytes to secondary lymphoid organs. It is a high affinity functional ligand for chemokine receptor 7 (CCR7) that is expressed on T and B lymphocytes and a known receptor for another member of the cytokine family (small inducible cytokine A19). [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CCL21
• Entrez:
  • 6366(Human)
• Uniprot:
  • NP_002980.1(Human)