CCL21/6Ckine Antibody

Images

 
Western Blot: CCL21/6Ckine Antibody [H00006366-B01P] - Analysis of CCL21 expression in transfected 293T cell line by CCL21 polyclonal antibody. Lane 1: CCL21 transfected lysate(14.74 KDa). Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CCL21/6Ckine Antibody Summary

Immunogen
CCL21 (NP_002980.1, 1 a.a. - 134 a.a.) full-length human protein. MAQSLALSLLILVLAFGIPRTQGSDGGAQDCCLKYSQRKIPAKVVRSYRKQEPSLGCSIPAILFLPRKRSQAELCADPKELWVQQLMQHLDKTPSPQKPAQGCRKDRGASKTGKKGKGSKGCKRTERSQTPKGP
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
CCL21
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CCL21/6Ckine Antibody

  • 6Ckine
  • 6CkineSmall-inducible cytokine A21
  • Beta-chemokine exodus-2
  • CCL21
  • chemokine (C-C motif) ligand 21
  • CKb9
  • exodus-2
  • member 21
  • SCYA21
  • SCYA21MGC34555
  • secondary lymphoid tissue chemokine
  • SLC
  • SLCSecondary lymphoid-tissue chemokine
  • TCA-4

Background

This gene is one of several CC cytokine genes clustered on the p-arm of chromosome 9. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. Similar to other chemokines the protein encoded by this gene inhibits hemopoiesis and stimulates chemotaxis. This protein is chemotactic in vitro for thymocytes and activated T cells, but not for B cells, macrophages, or neutrophils. The cytokine encoded by this gene may also play a role in mediating homing of lymphocytes to secondary lymphoid organs. It is a high affinity functional ligand for chemokine receptor 7 (CCR7) that is expressed on T and B lymphocytes and a known receptor for another member of the cytokine family (small inducible cytokine A19).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB197
Species: Hu
Applications: Flow, CyTOF-reported, ICC, Neut
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
AF470
Species: Mu
Applications: WB, IHC, Neut
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
MAB172
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
MAB2358
Species: Hu, Mu
Applications: IHC, ICC
H00006366-B01P
Species: Hu
Applications: WB

Publications for CCL21/6Ckine Antibody (H00006366-B01P) (0)

There are no publications for CCL21/6Ckine Antibody (H00006366-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCL21/6Ckine Antibody (H00006366-B01P) (0)

There are no reviews for CCL21/6Ckine Antibody (H00006366-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CCL21/6Ckine Antibody (H00006366-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CCL21/6Ckine Products

Bioinformatics Tool for CCL21/6Ckine Antibody (H00006366-B01P)

Discover related pathways, diseases and genes to CCL21/6Ckine Antibody (H00006366-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCL21/6Ckine Antibody (H00006366-B01P)

Discover more about diseases related to CCL21/6Ckine Antibody (H00006366-B01P).
 

Pathways for CCL21/6Ckine Antibody (H00006366-B01P)

View related products by pathway.

PTMs for CCL21/6Ckine Antibody (H00006366-B01P)

Learn more about PTMs related to CCL21/6Ckine Antibody (H00006366-B01P).
 

Research Areas for CCL21/6Ckine Antibody (H00006366-B01P)

Find related products by research area.

Blogs on CCL21/6Ckine

There are no specific blogs for CCL21/6Ckine, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCL21/6Ckine Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCL21
Entrez
Uniprot