CCL14/HCC-1/HCC-3 Antibody (1F12) - Azide and BSA Free

Western Blot: CCL14/HCC-1/HCC-3 Antibody (1F12) [H00006358-M01] - Analysis of CCL14 expression in transfected 293T cell line by CCL14 monoclonal antibody (M01), clone 1F12.Lane 1: CCL14 transfected lysate(10.7 KDa).Lane 2: Non-transfected lysate.

ELISA: CCL14/HCC-1/HCC-3 Antibody (1F12) [H00006358-M01] - Detection limit for recombinant GST tagged CCL14 is approximately 0.3ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1F12
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

CCL14/HCC-1/HCC-3 Antibody (1F12) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: CCL14 (AAH45165, 20 a.a. ~ 93 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN
• Specificity: CCL14 - chemokine (C-C motif) ligand 14
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CCL14
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CCL14/HCC-1/HCC-3 Antibody (1F12) - Azide and BSA Free

• C-C motif chemokine 14
• CCL14
• chemokine (C-C motif) ligand 14
• Chemokine CC-1/CC-3
• chemokine CC-3
• CKB1
• FLJ16015
• HCC-1
• HCC-1(1-74)
• HCC-1/HCC-3
• HCC-3
• hemofiltrate CC chemokine 1
• MCIF
• member 14
• NCC2CC-1
• NCC-2CKb1
• new CC chemokine 2
• SCYA14CC-3
• Small-inducible cytokine A14

Background

This gene, CCL14, is one of several CC cytokine genes clustered on 17q11.2. The CC cytokines are secreted proteins characterized by two adjacent cysteines. The cytokine encoded by this gene induces changes in intracellular calcium concentration and enzyme release in monocytes. This gene expresses both monocistronic and bicistronic transcripts. Bicistronic transcripts include the upstream cytokine gene CCL15. In addition, CCL14 undergoes alternative splicing in the bicistronic transcripts; it is unknown if its monocistronic transcript is also subject to alternative splicing.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CCL14
• Entrez:
  • 6358(Human)
• OMIM:
  • 601392(Human)
• Uniprot:
  • AAH45165(Human)