CCL14/HCC-1/HCC-3 Antibody (1F12)

Images

 
Western Blot: CCL14/HCC-1/HCC-3 Antibody (1F12) [H00006358-M01] - Analysis of CCL14 expression in transfected 293T cell line by CCL14 monoclonal antibody (M01), clone 1F12.Lane 1: CCL14 transfected lysate(10.7 KDa).Lane ...read more
ELISA: CCL14/HCC-1/HCC-3 Antibody (1F12) [H00006358-M01] - Detection limit for recombinant GST tagged CCL14 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1F12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CCL14/HCC-1/HCC-3 Antibody (1F12) Summary

Immunogen
CCL14 (AAH45165, 20 a.a. - 93 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TKTESSSRGPYHPSECCFTYTTYKIPRQRIMDYYETNSQCSKPGIVFITKRGHSVCTNPSDKWVQDYIKDMKEN
Specificity
CCL14 - chemokine (C-C motif) ligand 14
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CCL14
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CCL14/HCC-1/HCC-3 Antibody (1F12)

  • C-C motif chemokine 14
  • CCL14
  • chemokine (C-C motif) ligand 14
  • Chemokine CC-1/CC-3
  • chemokine CC-3
  • CKB1
  • FLJ16015
  • HCC-1
  • HCC-1(1-74)
  • HCC-1/HCC-3
  • HCC-3
  • hemofiltrate CC chemokine 1
  • MCIF
  • member 14
  • NCC2CC-1
  • NCC-2CKb1
  • new CC chemokine 2
  • SCYA14CC-3
  • Small-inducible cytokine A14

Background

This gene, CCL14, is one of several CC cytokine genes clustered on 17q11.2. The CC cytokines are secreted proteins characterized by two adjacent cysteines. The cytokine encoded by this gene induces changes in intracellular calcium concentration and enzyme release in monocytes. This gene expresses both monocistronic and bicistronic transcripts. Bicistronic transcripts include the upstream cytokine gene CCL15. In addition, CCL14 undergoes alternative splicing in the bicistronic transcripts; it is unknown if its monocistronic transcript is also subject to alternative splicing.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB363
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
MAB145
Species: Hu
Applications: Flow, CyTOF-ready
MAB182
Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut
MAB328
Species: Hu
Applications: WB, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), ICFlow, Neut, ELISA(Sta)
MAB155
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
AF4840
Species: Hu
Applications: WB
NBP2-45937
Species: Hu
Applications: WB, IHC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP2-13980
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
AF1180
Species: Hu
Applications: WB, Simple Western, IHC, ICC

Publications for CCL14/HCC-1/HCC-3 Antibody (H00006358-M01) (0)

There are no publications for CCL14/HCC-1/HCC-3 Antibody (H00006358-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCL14/HCC-1/HCC-3 Antibody (H00006358-M01) (0)

There are no reviews for CCL14/HCC-1/HCC-3 Antibody (H00006358-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CCL14/HCC-1/HCC-3 Antibody (H00006358-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CCL14/HCC-1/HCC-3 Products

Bioinformatics Tool for CCL14/HCC-1/HCC-3 Antibody (H00006358-M01)

Discover related pathways, diseases and genes to CCL14/HCC-1/HCC-3 Antibody (H00006358-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCL14/HCC-1/HCC-3 Antibody (H00006358-M01)

Discover more about diseases related to CCL14/HCC-1/HCC-3 Antibody (H00006358-M01).
 

Pathways for CCL14/HCC-1/HCC-3 Antibody (H00006358-M01)

View related products by pathway.

PTMs for CCL14/HCC-1/HCC-3 Antibody (H00006358-M01)

Learn more about PTMs related to CCL14/HCC-1/HCC-3 Antibody (H00006358-M01).
 

Research Areas for CCL14/HCC-1/HCC-3 Antibody (H00006358-M01)

Find related products by research area.

Blogs on CCL14/HCC-1/HCC-3

There are no specific blogs for CCL14/HCC-1/HCC-3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCL14/HCC-1/HCC-3 Antibody (1F12) and receive a gift card or discount.

Bioinformatics

Gene Symbol CCL14
Entrez
OMIM
Uniprot