CCDC6 Antibody (5D11)

Images

 
Western Blot: CCDC6 Antibody (5D11) [H00008030-M03] - Analysis of CCDC6 expression in K-562 (Cat # L009V1).
Sandwich ELISA: CCDC6 Antibody (5D11) [H00008030-M03] - Detection limit for recombinant GST tagged CCDC6 is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
5D11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CCDC6 Antibody (5D11) Summary

Immunogen
CCDC6 (NP_005427, 375 a.a. ~ 474 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HTVGFTPPTSLTRAGMSYYNSPGLHVQHMGTSHGITRPSPRRSNSPDKFKRPTPPPSPNTQTPVQPPPPPPPPPMQPTVPSAATSQPTPSQHSAHPSSQP
Specificity
CCDC6 - coiled-coil domain containing 6
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CCDC6
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CCDC6 Antibody (5D11)

  • coiled-coil domain containing 6
  • D10S170Protein H4
  • H4DNA segment on chromosome 10 (unique) 170
  • Papillary thyroid carcinoma-encoded protein
  • PTCFLJ32286
  • TPCcoiled-coil domain-containing protein 6
  • TST1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00008337-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NB100-56346
Species: Hu, Mu, Sh
Applications: ELISA, Flow, IHC, IHC-P, WB
NBP1-30141
Species: Ce, Dr, Hu, In, Ma, Mu, Po, Rt, Ye
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
AF482
Species: Mu
Applications: IHC, WB
NBP1-47668
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
1845-SH/CF
Species: Hu
Applications: BA
NBP2-03993
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
NBP1-47945
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-45184
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
H00002523-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP3-18136
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
H00003077-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P
NB100-56340
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB

Publications for CCDC6 Antibody (H00008030-M03) (0)

There are no publications for CCDC6 Antibody (H00008030-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCDC6 Antibody (H00008030-M03) (0)

There are no reviews for CCDC6 Antibody (H00008030-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CCDC6 Antibody (H00008030-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CCDC6 Products

Bioinformatics Tool for CCDC6 Antibody (H00008030-M03)

Discover related pathways, diseases and genes to CCDC6 Antibody (H00008030-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCDC6 Antibody (H00008030-M03)

Discover more about diseases related to CCDC6 Antibody (H00008030-M03).
 

Pathways for CCDC6 Antibody (H00008030-M03)

View related products by pathway.

PTMs for CCDC6 Antibody (H00008030-M03)

Learn more about PTMs related to CCDC6 Antibody (H00008030-M03).

Blogs on CCDC6.

The role of Smoothened in pulmonary pathologies
The Hedgehog (Hh) family of secreted proteins is involved in a number of developmental processes, one of which is the development of cancer. Past data suggests that the Sonic hedgehog (Shh) receptor is composed of two transmembrane proteins, Patche...  Read full blog post.

Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCDC6 Antibody (5D11) and receive a gift card or discount.

Bioinformatics

Gene Symbol CCDC6
Entrez
OMIM
Uniprot