CCDC25 Antibody

Images

 
Western Blot: CCDC25 Antibody [NBP1-83821] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-107
Immunocytochemistry/ Immunofluorescence: CCDC25 Antibody [NBP1-83821] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & the Golgi apparatus.
Immunohistochemistry-Paraffin: CCDC25 Antibody [NBP1-83821] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CCDC25 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SSAYTIYMGKDKYENEDLIKHGWPEDIWFHVDKLSSAHVYLRLHKGENIEDIPKEVLMD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCDC25
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CCDC25 Protein (NBP1-83821PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CCDC25 Antibody

  • coiled-coil domain containing 25
  • coiled-coil domain-containing protein 25
  • FLJ10853

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-52556
Species: Hu, Mu, Po, Bt, Bv, Ca, Mk, Pm, Rb
Applications: IHC-P
AF527
Species: Mu
Applications: WB, IHC, Block, ICC
NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83701
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45396
Species: Hu
Applications: WB, Flow, IHC
NBP2-20861
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP1-84625
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF6260
Species: Hu
Applications: WB
AF877
Species: Hu
Applications: WB, IHC, IP
NB100-56530
Species: Hu
Applications: WB
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-33687
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29915
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-82157
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CCDC25 Antibody (NBP1-83821) (0)

There are no publications for CCDC25 Antibody (NBP1-83821).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCDC25 Antibody (NBP1-83821) (0)

There are no reviews for CCDC25 Antibody (NBP1-83821). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CCDC25 Antibody (NBP1-83821) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CCDC25 Products

Bioinformatics Tool for CCDC25 Antibody (NBP1-83821)

Discover related pathways, diseases and genes to CCDC25 Antibody (NBP1-83821). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCDC25 Antibody (NBP1-83821)

Discover more about diseases related to CCDC25 Antibody (NBP1-83821).

Blogs on CCDC25

There are no specific blogs for CCDC25, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCDC25 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCDC25