![Western Blot: SH2D4A Antibody [NBP1-82157] - Staining in human urinary bladder and testis tissues using anti-SH2D4A antibody. Corresponding SH2D4A RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/SH2D4A-Antibody-Western-Blot-NBP1-82157-img0013.jpg "Western Blot: SH2D4A Antibody [NBP1-82157] - Staining in human urinary bladder and testis tissues using anti-SH2D4A antibody. Corresponding SH2D4A RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit SH2D4A Antibody - BSA Free (NBP1-82157) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KEEQLPLRAGYQKTSDTIAPWFHGILTLKKANELLLSTGMPGSFLIRVSERIKGYALSYLSEDGCKHFLIDASADAYSFLGVDQLQHATLADLVEYHKEEPITSLGKELLLYPCGQQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | SH2D4A |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot ZAG Antibody [Unconjugated]](https://images.novusbio.com/images2/ZAG_AF4764_Western_Blot_5541.jpg)
![Immunohistochemistry ZAG Antibody [Unconjugated]](https://images.novusbio.com/images2/ZAG_AF4764_Immunohistochemistry_11702.jpg)
![Immunocytochemistry ZAG Antibody [Unconjugated]](https://images.novusbio.com/images2/ZAG_AF4764_Immunocytochemistry__Immunofluorescence_20270.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for SH2D4A Antibody (NBP1-82157)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | SH2D4A |
![Immunocytochemistry/Immunofluorescence: SH2D4A Antibody [NBP1-82157] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.](http://images.novusbio.com/fullsize/SH2D4A-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-82157-img0009.jpg "Immunocytochemistry/Immunofluorescence: SH2D4A Antibody [NBP1-82157] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol.")
![Immunohistochemistry-Paraffin: SH2D4A Antibody [NBP1-82157] - Staining of human urinary bladder shows high expression.](http://images.novusbio.com/fullsize/SH2D4A-Antibody-Immunohistochemistry-Paraffin-NBP1-82157-img0012.jpg "Immunohistochemistry-Paraffin: SH2D4A Antibody [NBP1-82157] - Staining of human urinary bladder shows high expression.")
![Western Blot: SH2D4A Antibody [NBP1-82157] - Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human cell line A-431. Lane 5: Human liver tissue](http://images.novusbio.com/fullsize/SH2D4A-Antibody-Western-Blot-NBP1-82157-img0005.jpg "Western Blot: SH2D4A Antibody [NBP1-82157] - Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 18. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human cell line A-431. Lane 5: Human liver tissue")
![Western Blot: SH2D4A Antibody [NBP1-82157] - Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate](http://images.novusbio.com/fullsize/SH2D4A-Antibody-Western-Blot-NBP1-82157-img0007.jpg "Western Blot: SH2D4A Antibody [NBP1-82157] - Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate")
![Immunohistochemistry-Paraffin: SH2D4A Antibody [NBP1-82157] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/SH2D4A-Antibody-Immunohistochemistry-Paraffin-NBP1-82157-img0010.jpg "Immunohistochemistry-Paraffin: SH2D4A Antibody [NBP1-82157] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: SH2D4A Antibody [NBP1-82157] - Staining of human testis shows low expression as expected.](http://images.novusbio.com/fullsize/SH2D4A-Antibody-Immunohistochemistry-Paraffin-NBP1-82157-img0011.jpg "Immunohistochemistry-Paraffin: SH2D4A Antibody [NBP1-82157] - Staining of human testis shows low expression as expected.")
![Immunohistochemistry EphA3 Antibody [Unconjugated]](https://images.novusbio.com/images2/EphA3_AF640_Immunohistochemistry_19184.jpg)
![Bioactivity IL-2 [Unconjugated]](https://images.novusbio.com/images/202-il_recombinant-human-il-2-protein-bioactivity-174202314946.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")