CCBL2 Antibody - BSA Free

Immunohistochemistry-Paraffin: CCBL2 Antibody [NBP1-87388] - Staining of human endometrium, placenta, skeletal muscle and testis using Anti-KYAT3 antibody NBP1-87388 (A) shows similar protein distribution across tissues to independent antibody NBP1-87387 (B).

Immunohistochemistry-Paraffin: CCBL2 Antibody [NBP1-87388] - Staining of human testis shows strong granular cytoplasm positivity in Leydig cells and cells in seminiferous ducts.

Immunohistochemistry-Paraffin: CCBL2 Antibody [NBP1-87388] - Staining of human endometrium shows strong granular cytoplasm positivity in glandular cells.

Immunohistochemistry-Paraffin: CCBL2 Antibody [NBP1-87388] - Staining of human placenta shows strong granular cytoplasm positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: CCBL2 Antibody [NBP1-87388] - Staining of human skeletal muscle shows moderate granular cytoplasm positivity in myocytes.

Immunohistochemistry-Paraffin: CCBL2 Antibody [NBP1-87388] - Staining of human thyroid gland shows strong granular cytoplasm positivity in glandular cells.

• Reactivity: Hu, Mu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CCBL2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: VTGWKLGWSIGPNHLIKHLQTVQQNTIYTCATPLQEALAQAFWIDIKRMDDPECYFNSLPKELEVKRDRMVRLLESVG
• Predicted Species: Mouse (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CCBL2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CCBL2 Protein (NBP1-87388PEP)

Reactivity Notes

Rat (82%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CCBL2 Antibody - BSA Free

• cysteine conjugate-beta lyase 2
• Cysteine-S-conjugate beta-lyase 2
• DKFZp547N1117
• EC 2.6.1.63
• EC 2.6.1.7
• EC 4.4.1.13
• KAT3DKFZp667D0223
• KATIII
• Kynurenine aminotransferase III
• Kynurenine--glyoxylate transaminase
• kynurenine-oxoglutarate transaminase 3
• kynurenine--oxoglutarate transaminase 3
• Kynurenine--oxoglutarate transaminase III
• MGC9398
• RBM1
• RP11-82K18.3
• RP4-531M19.2

Background

The CCBL2 gene encodes an aminotransferase that transaminates kynurenine to form kynurenic acid. Kynurenic acid is a metabolite of tryptophan. Multiple alternatively spliced transcript variants that encode different proteins have been described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CCBL2