CCBL2 Antibody


Western Blot: CCBL2 Antibody [NBP1-87388] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: CCBL2 Antibody [NBP1-87388] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
Western Blot: CCBL2 Antibody [NBP1-87388] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Reactivity Hu, Mu, Rt, MuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

CCBL2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:VTGWKLGWSIGPNHLIKHLQTVQQNTIYTCATPLQEALAQAFWIDIKRMDDPECYFNSLPKELEVKRDRMVRLLESVG
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CCBL2 Protein (NBP1-87388PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CCBL2 Antibody

  • cysteine conjugate-beta lyase 2
  • Cysteine-S-conjugate beta-lyase 2
  • DKFZp547N1117
  • EC
  • EC
  • EC
  • KAT3DKFZp667D0223
  • Kynurenine aminotransferase III
  • Kynurenine--glyoxylate transaminase
  • kynurenine-oxoglutarate transaminase 3
  • kynurenine--oxoglutarate transaminase 3
  • Kynurenine--oxoglutarate transaminase III
  • MGC9398
  • RBM1
  • RP11-82K18.3
  • RP4-531M19.2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, IHC, ICC
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ChIP, IP, PLA
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ChIP, IP
Species: Hu
Species: Hu, Mu, Rt, Mu
Applications: WB, IHC, IHC-P

Publications for CCBL2 Antibody (NBP1-87388) (0)

There are no publications for CCBL2 Antibody (NBP1-87388).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCBL2 Antibody (NBP1-87388) (0)

There are no reviews for CCBL2 Antibody (NBP1-87388). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CCBL2 Antibody (NBP1-87388) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CCBL2 Products

Bioinformatics Tool for CCBL2 Antibody (NBP1-87388)

Discover related pathways, diseases and genes to CCBL2 Antibody (NBP1-87388). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on CCBL2

There are no specific blogs for CCBL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CCBL2 Antibody and receive a gift card or discount.


Gene Symbol CCBL2