CCBL2 Antibody

Images

 
Western Blot: CCBL2 Antibody [NBP1-87387] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: CCBL2 Antibody [NBP1-87387] - Immunofluorescent staining of human cell line U-251 MG shows localization to nucleoli & cytosol.
Immunohistochemistry-Paraffin: CCBL2 Antibody [NBP1-87387] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.
Western Blot: CCBL2 Antibody [NBP1-87387] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CCBL2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PDGGYFIIADVSLLDPDLSDMKNNEPYDYKFVKWMTKHKKLSAIPVSAFCNSETKSQFEKFVRFCFIKKDSTLDAAEEIIKAWSVQKS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCBL2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:1000-1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CCBL2 Protein (NBP1-87387PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CCBL2 Antibody

  • cysteine conjugate-beta lyase 2
  • Cysteine-S-conjugate beta-lyase 2
  • DKFZp547N1117
  • EC 2.6.1.63
  • EC 2.6.1.7
  • EC 4.4.1.13
  • KAT3DKFZp667D0223
  • KATIII
  • Kynurenine aminotransferase III
  • Kynurenine--glyoxylate transaminase
  • kynurenine-oxoglutarate transaminase 3
  • kynurenine--oxoglutarate transaminase 3
  • Kynurenine--oxoglutarate transaminase III
  • MGC9398
  • RBM1
  • RP11-82K18.3
  • RP4-531M19.2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF7817
Species: Hu, Mu, Rt
Applications: WB
AF1103
Species: Hu
Applications: WB, IHC, ICC
NBP2-01383
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87835
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NBP2-14873
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89627
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
H00008349-M06
Species: Hu
Applications: ELISA, IHC-P
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-2242
Species: Hu, Mu
Applications: WB, ChIP, IP
H00005956-R02
Species: Hu
NBP1-87387
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CCBL2 Antibody (NBP1-87387) (0)

There are no publications for CCBL2 Antibody (NBP1-87387).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCBL2 Antibody (NBP1-87387) (0)

There are no reviews for CCBL2 Antibody (NBP1-87387). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CCBL2 Antibody (NBP1-87387) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CCBL2 Products

Bioinformatics Tool for CCBL2 Antibody (NBP1-87387)

Discover related pathways, diseases and genes to CCBL2 Antibody (NBP1-87387). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on CCBL2

There are no specific blogs for CCBL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCBL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCBL2