CCBL2 Antibody

Images

 
Western Blot: CCBL2 Antibody [NBP1-70487] - Jurkat cell lysate, concentration 2.5 ug/ml.
Western Blot: CCBL2 Antibody [NBP1-70487] - Antibody Titration: 2.5 ug/ml Positive control: Jurkat cell lysate CCBL2 is supported by BioGPS gene expression data to be expressed in Jurkat.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CCBL2 Antibody Summary

Immunogen
Synthetic peptides corresponding to RP11-82K18.3 The peptide sequence was selected from the N terminal of RP11-82K18.3. Peptide sequence SGRAKFLKTISSSKILGFSTSAKMSLKFTNAKRIEGLDSNVWIEFTKLAA.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCBL2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 2.5 ug/ml
Application Notes
This is a rabbit polyclonal antibody against RP11-82K18.3 and was validated on Western blot.
Theoretical MW
46 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CCBL2 Antibody

  • cysteine conjugate-beta lyase 2
  • Cysteine-S-conjugate beta-lyase 2
  • DKFZp547N1117
  • EC 2.6.1.63
  • EC 2.6.1.7
  • EC 4.4.1.13
  • KAT3DKFZp667D0223
  • KATIII
  • Kynurenine aminotransferase III
  • Kynurenine--glyoxylate transaminase
  • kynurenine-oxoglutarate transaminase 3
  • kynurenine--oxoglutarate transaminase 3
  • Kynurenine--oxoglutarate transaminase III
  • MGC9398
  • RBM1
  • RP11-82K18.3
  • RP4-531M19.2

Background

RP11-82K18.3 is an aminotransferase that transaminates kynurenine to form kynurenic acid. Kynurenic acid is a metabolite of tryptophan.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF7817
Species: Hu, Mu, Rt
Applications: WB
AF1103
Species: Hu
Applications: WB, IHC, ICC
NBP2-01383
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-87835
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NBP2-14873
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89627
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
H00008349-M06
Species: Hu
Applications: ELISA, IHC-P
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NB100-2242
Species: Hu, Mu
Applications: WB, ChIP, IP
H00005956-R02
Species: Hu
NBP1-70487
Species: Hu
Applications: WB

Publications for CCBL2 Antibody (NBP1-70487) (0)

There are no publications for CCBL2 Antibody (NBP1-70487).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCBL2 Antibody (NBP1-70487) (0)

There are no reviews for CCBL2 Antibody (NBP1-70487). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CCBL2 Antibody (NBP1-70487) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CCBL2 Products

Bioinformatics Tool for CCBL2 Antibody (NBP1-70487)

Discover related pathways, diseases and genes to CCBL2 Antibody (NBP1-70487). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on CCBL2

There are no specific blogs for CCBL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCBL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCBL2