CCAR1 Antibody - BSA Free

Western Blot: CCAR1 Antibody [NBP3-35368] - Western blot analysis of various lysates using CCAR1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 5s.

Immunoprecipitation: CCAR1 Antibody [NBP3-35368] - Immunoprecipitation analysis of 200 ug extracts of HeLa cells using 3 ug CCAR1 antibody. Western blot was performed from the immunoprecipitate using CCAR1 antibody at a dilution of 1:500.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CCAR1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CCAR1 Antibody - BSA Free (NBP3-35368) is a polyclonal antibody validated for use in WB, ELISA and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-200 of human CCAR1 (NP_060707.2).
  
  Sequence:
  MAQFGGQKNPPWATQFTATAVSQPAALGVQQPSLLGASPTIYTQQTALAAAGLTTQTPANYQLTQTAALQQQAAAAAAALQQQYSQPQQALYSVQQQLQQPQQTLLTQPAVALPTSLSLSTPQPTAQITVSYPTPRSSQQQTQPQKQRVFTGVVTKLHDTFGFVDEDVFFQLSAVKGKTPQVGDRVLVEATYNPNMPFKW
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CCAR1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoprecipitation 0.5ug - 4ug antibody for 200ug - 400ug extracts of whole cells
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 133 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CCAR1 Antibody - BSA Free

• CARP-1
• CARP1MGC44628
• Cell cycle and apoptosis regulatory protein 1
• cell division cycle and apoptosis regulator 1
• cell division cycle and apoptosis regulator protein 1
• Death inducer with SAP domain
• DIS
• FLJ10590
• RP11-437A18.1

Background

Associates with components of the Mediator and p160 coactivator complexes that play a role as intermediaries transducing regulatory signals from upstream transcriptional activator proteins to basal transcription machinery at the core promoter. Recruited to endogenous nuclear receptor target genes in response to the appropriate hormone. Also functions as a p53 coactivator. May thus play an important role in transcriptional regulation . May be involved in apoptosis signaling in the presence of the reinoid CD437. Apoptosis induction involves sequestration of 14-3-3 protein(s) and mediated altered expression of multiple cell cycle regulatory genes including MYC, CCNB1 and CDKN1A. Plays a role in cell cycle progression and/or cell proliferation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CCAR1