CCAR1 Antibody

Images

 
Immunohistochemistry-Paraffin: CCAR1 Antibody [NBP2-55611] - Immunohistochemical staining of human tonsil shows strong nuclear positivity in germinal center cells and non-germinal center cells

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CCAR1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KEERDDETEEDNNQDEYDPMEAEEAEDEEDDRDEEEMTKRDDKRDINRYCKERPSKDKEKEKTQMITINRDLLMAFVYFDQSHCGYLLE
Specificity
Specificity of human CCAR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCAR1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CCAR1 Recombinant Protein Antigen (NBP2-55611PEP)

Reactivity Notes

Mouse 83%, Rat 84%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for CCAR1 Antibody

  • CARP-1
  • CARP1MGC44628
  • Cell cycle and apoptosis regulatory protein 1
  • cell division cycle and apoptosis regulator 1
  • cell division cycle and apoptosis regulator protein 1
  • Death inducer with SAP domain
  • DIS
  • FLJ10590
  • RP11-437A18.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16382
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB120-22711
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-56413
Species: Hu
Applications: WB, ICC/IF, IP
NBP2-47609
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00009014-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-88543
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2187
Species: Hu, Mu
Applications: WB, Simple Western, IP
NBP2-15397
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-46290
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-08611
Species: Hu
NBP1-88376
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB6200
Species: Hu
Applications: WB, IHC, KO
NBP1-83426
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-207
Species: Hu, Mu, Ce
Applications: WB, IHC, IHC-P, IP
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc

Publications for CCAR1 Antibody (NBP2-55611) (0)

There are no publications for CCAR1 Antibody (NBP2-55611).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CCAR1 Antibody (NBP2-55611) (0)

There are no reviews for CCAR1 Antibody (NBP2-55611). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CCAR1 Antibody (NBP2-55611) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional CCAR1 Products

Array NBP2-55611

Bioinformatics Tool for CCAR1 Antibody (NBP2-55611)

Discover related pathways, diseases and genes to CCAR1 Antibody (NBP2-55611). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CCAR1 Antibody (NBP2-55611)

Discover more about diseases related to CCAR1 Antibody (NBP2-55611).
 

Pathways for CCAR1 Antibody (NBP2-55611)

View related products by pathway.

PTMs for CCAR1 Antibody (NBP2-55611)

Learn more about PTMs related to CCAR1 Antibody (NBP2-55611).
 

Research Areas for CCAR1 Antibody (NBP2-55611)

Find related products by research area.

Blogs on CCAR1

There are no specific blogs for CCAR1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CCAR1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CCAR1