CCAR1 Antibody - BSA Free

Immunohistochemistry-Paraffin: CCAR1 Antibody [NBP2-55611] - Immunohistochemical staining of human tonsil shows strong nuclear positivity in germinal center cells and non-germinal center cells

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CCAR1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KEERDDETEEDNNQDEYDPMEAEEAEDEEDDRDEEEMTKRDDKRDINRYCKERPSKDKEKEKTQMITINRDLLMAFVYFDQSHCGYLLE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CCAR1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CCAR1 Recombinant Protein Antigen (NBP2-55611PEP)

Reactivity Notes

Mouse 83%, Rat 84%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for CCAR1 Antibody - BSA Free

• CARP-1
• CARP1MGC44628
• Cell cycle and apoptosis regulatory protein 1
• cell division cycle and apoptosis regulator 1
• cell division cycle and apoptosis regulator protein 1
• Death inducer with SAP domain
• DIS
• FLJ10590
• RP11-437A18.1

Background

Associates with components of the Mediator and p160 coactivator complexes that play a role as intermediaries transducing regulatory signals from upstream transcriptional activator proteins to basal transcription machinery at the core promoter. Recruited to endogenous nuclear receptor target genes in response to the appropriate hormone. Also functions as a p53 coactivator. May thus play an important role in transcriptional regulation . May be involved in apoptosis signaling in the presence of the reinoid CD437. Apoptosis induction involves sequestration of 14-3-3 protein(s) and mediated altered expression of multiple cell cycle regulatory genes including MYC, CCNB1 and CDKN1A. Plays a role in cell cycle progression and/or cell proliferation

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CCAR1