CBS Antibody (3E1) Summary
Description |
Quality control test: Antibody Reactive Against Recombinant Protein. |
Immunogen |
CBS (NP_000062, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFG |
Specificity |
CBS - cystathionine-beta-synthase |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
CBS |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Immunohistochemistry 1:10-1:500
- Immunohistochemistry-Frozen
- Immunohistochemistry-Paraffin 1:10-1:500
- Immunoprecipitation 1:10-1:500
- Knockdown Validated
- Western Blot 1:500
|
Application Notes |
Antibody reactivity against cell lysate, transfected lysate and recombinant protein for WB. It has been used for IHC-P, RNAi Validation and ELISA. ICC/IF usage reported in scientific literature (PMID: 21571312). |
Reviewed Applications |
Read 1 Review rated 3 using H00000875-M01 in the following applications:
|
|
Publications |
Read Publications using H00000875-M01 in the following applications:
|
|
Reactivity Notes
Rat reactivity reported in scientific literature (PMID: 24611772). Mouse reactivity reported in scientific literature (PMID: 22419888).
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for CBS Antibody (3E1)
Background
The protein encoded by this gene is involved in the transsulfuration pathway. The first step of this pathway, from homocysteine to cystathionine, is catalyzed by this protein. CBS deficiency can cause homocystinuria which affects many organs and tissues, including the eyes and the skeletal, vascular and central nervous systems.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, Â IHC-P, WB
Species: Gp, Hu, Mu, Po, Rt
Applications: ELISA, ICC/IF, IHC, Â IHC-P, WB
Species: Hu, Mu
Applications: IHC, Â IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: IHC, Â IHC-P, WB
Species: Hu
Applications: IHC, Â IHC-P, WB
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, Â IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, Â IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, Â IHC-P, WB
Species: Hu, Mu
Applications: IHC, Â IHC-P, WB
Species: Hu
Applications: IHC
Species: Hu, Mu, Rt
Applications: IHC, Â IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CBS Antibody (H00000875-M01). (Showing 1 - 2 of 2 FAQs).
-
We would like to check on Cystathionine beta synthase # H00000875-M01. We need a mouse monoclonal. Applications: Immunoblotting, IHC May I know if this can cross-react with mouse CBS? Because we are actually probing this enzyme in a mouse cell line / tissue and the species is human, host is mouse.
- This antibody has never been tested against mouse samples so we don't know if it will cross react. I recommend checking with a blast against the mouse protein to find out how similar the immunogen is to the mouse protein. If it is 80% homologous or higher typically there is a good chance it might react. In addition to using an anti-mouse secondary will bind non-specifically to their mouse tissues, and most likely cause high background. Running a secondary only control would be advised or even better increase the concentration of the primary on their samples and use a directly conjugated version to avoid non-specific secondary binding. In this case we can recommend our Innovators Reward Program. Our Innovator's Reward is offered to reward researchers for testing new species and applications with our products. If testing on this antibody is performed on an untested species and/or application, and the results are shared, then the antibody is eligible for the Innovator's Reward. Under this program, Novus will provide you a credit of equal or lesser value on a future product of equal value in exchange for your new data in the form of an online review. The great thing is you are eligible even if the antibody doesn't work because the data is still useful to us.
-
I was wondering if the CBS Antibody (3E1) (H00000875-M01) has been used for immunofluorescence on monolayer cell cultures?
- Unfortunately it has never been tested for immunofluorescence in an ICC application on cells. Since it stains tissue, I would imagine it should be capable of staining cells as well. Without testing we cannot guarantee this, but if you want to test using our Innovators Reward Program to save some money for providing feedback that is an option for you. Here are the details: If you would like to test this antibody in an untested species and/or application and share your results with us, then I can recommend our Innovators Reward program. Under this program, Novus will provide you a 50% refund on the purchased product as well as a 50% discount on a future product of equal value in exchange for your new data. The great thing is you are eligible regardless if you get positive results or not.
Secondary Antibodies
| |
Isotype Controls
|
Additional CBS Products
Research Areas for CBS Antibody (H00000875-M01)
Find related products by research area.
|
Blogs on CBS