CBS Antibody (3E1)

Western Blot: CBS Antibody (3E1) [H00000875-M01] - Analysis of CBS expression in transfected 293T cell line by CBS monoclonal antibody (M01), clone 3E1.Lane 1: CBS transfected lysate(61 KDa).Lane 2: Non-transfected lysate.

Immunohistochemistry-Paraffin: CBS Antibody (3E1) [H00000875-M01] - Analysis of monoclonal antibody to CBS on formalin-fixed paraffin-embedded human hepatocellular carcinoma. Antibody concentration 3 ug/ml.

Western Blot: CBS Antibody (3E1) [H00000875-M01] - Analysis of CBS over-expressed 293 cell line, cotransfected with CBS Validated Chimera RNAi ( Cat # H00000875-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with CBS monoclonal antibody (M01), clone 3E1 (Cat # H00000875-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.

Western Blot: CBS Antibody (3E1) [H00000875-M01] - CBS monoclonal antibody (M01), clone 3E1 Analysis of CBS expression in HeLa.

Western Blot: CBS Antibody (3E1) [H00000875-M01] - CBS monoclonal antibody (M01), clone 3E1. Analysis of CBS expression in MCF-7.

Immunoprecipitation: CBS Antibody (3E1) [H00000875-M01] - Analysis of CBS transfected lysate using anti-CBS monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CBS MaxPab rabbit polyclonal antibody.

ELISA: CBS Antibody (3E1) [H00000875-M01] - Detection limit for recombinant GST tagged CBS is approximately 0.1ng/ml as a capture antibody.

Product Discontinued

CBS Antibody (3E1) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: CBS (NP_000062, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFG
• Specificity: CBS - cystathionine-beta-synthase
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CBS
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Frozen
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Immunoprecipitation 1:10-1:500
  • Knockdown Validated
  • Western Blot 1:500
• Application Notes: Antibody reactivity against cell lysate, transfected lysate and recombinant protein for WB. It has been used for IHC-P, RNAi Validation and ELISA. ICC/IF usage reported in scientific literature (PMID: 21571312).

Reactivity Notes

Rat reactivity reported in scientific literature (PMID: 24611772). Mouse reactivity reported in scientific literature (PMID: 22419888).

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CBS Antibody (3E1)

• cystathionine-beta-synthase
• EC 4.2.1.2210Beta-thionase

Background

The protein encoded by this gene is involved in the transsulfuration pathway. The first step of this pathway, from homocysteine to cystathionine, is catalyzed by this protein. CBS deficiency can cause homocystinuria which affects many organs and tissues, including the eyes and the skeletal, vascular and central nervous systems.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CBS Antibody (H00000875-M01)(57)

Publications using H00000875-M01

• Qamarul A, Tomoaki I, Masanobu M et al. Synthesis of Sulfides and Persulfides Is Not Impeded by Disruption of Three Canonical Enzymes in Sulfur Metabolism. Antioxidants (Basel). 2023-04-03 [PMID: 37107243]
• Hwang SY, Sarna LK, Siow YL et al. High fat diet stimulates hepatic cystathionine ?-synthase and cystathionine ?-lyase expression. Canadian Journal of Physiology and Pharmacology Jun 13 2013
• Tain Y, Hou C, Chang-Chien G et al. Protection by Means of Perinatal Oral Sodium Thiosulfate Administration against Offspring Hypertension in a Rat Model of Maternal Chronic Kidney Disease Antioxidants 2023-06-26 [PMID: 37507884] (WB, Rat)
  
  Details:
  1:500 WB dilution
• Doyoung K, Seung S, Sou K et al. Effects of dietary restriction on hepatic sulfur-containing amino acid metabolism and its significance in acetaminophen-induced liver injury. J Nutr Biochem. 2022-06-10 [PMID: 35697284]
• Halina J, Maria W, Ewa J et al. Sulfurtransferases and Cystathionine Beta-Synthase Expression in Different Human Leukemia Cell Lines. Biomolecules. 2022-01-18 [PMID: 35204649]
• Bibli S, Hu J, Leisegang M et al. Shear stress regulates cystathionine ? lyase expression to preserve endothelial redox balance and reduce membrane lipid peroxidation. Redox Biol. 2019-11-13 [PMID: 31759247]
• Yue Shang Y, Siow YL, Isaak CK, Karmin O Downregulation of Glutathione Biosynthesis Contributes to Oxidative Stress and Liver Dysfunction in Acute Kidney Injury. Oxid Med Cell Longev 2016-01-01 [PMID: 27872680]
• Sekiguchi F, Sekimoto T, Ogura A, Kawabata A. Endogenous Hydrogen Sulfide Enhances Cell Proliferation of Human Gastric Cancer AGS Cells. Biol Pharm Bull 2016-05-13 [PMID: 27150157]
• Tai I, Sheen J, Lin Y et al. Maternal N-acetylcysteine therapy regulates hydrogen sulfide-generating pathway and prevents programmed hypertension in male offspring exposed to prenatal dexamethasone and postnatal high-fat diet. Nitric Oxide 2015-01-01 [PMID: 26743493]
• Ren YS, Wu SY, Wang XJ et al. Multiple hemodynamic effects of endogenous hydrogen sulfide on central nervous system in rats. Chin Med J Jun 5 2011
• Ohmura M, Hishiki T, Yamamoto T et al. Impacts of CD44 knockdown in cancer cells on tumor and host metabolic systems revealed by quantitative imaging mass spectrometry. Nitric Oxide Nov 11 2014
• Yuan B, Tang WH, Lu LJ et al. TLR4 upregulates CBS expression through NF-kB activation in a rat model of irritable bowel syndrome with chronic visceral hypersensitivity. World J Gastroenterol. 2015-07-28 [PMID: 26229403]
• Yuan B, Tang WH, Lu LJ et al. TLR4 upregulates CBS expression through NF-?B activation in a rat model of irritable bowel syndrome with chronic visceral hypersensitivity. World J Gastroenterol Jul 28 2015
• Fofou-Caillierez MB, Gueant-Rodriguez RM, Alberto JM et al. Vitamin B-12 and liver activity and expression of methionine synthase are decreased in fetuses with neural tube defects Am. J. Clin. Nutr. 2019-03-06 [PMID: 30848279] (WB, Human)
• Wang L, Cai H, Hu Y et al. A pharmacological probe identifies cystathionine ?-synthase as a new negative regulator for ferroptosis. Cell Death Dis 2018-09-26 [PMID: 30258181]
• Bibli SI, Luck B, Zukunft S et al. A selective and sensitive method for quantification of endogenous polysulfide production in biological samples. Redox Biol 2018-07-21 [PMID: 30077923]
• Ohmura M, Hishiki T, Yamamoto T et al. Impacts of CD44 knockdown in cancer cells on tumor and host metabolic systems revealed by quantitative imaging mass spectrometry. Nitric Oxide. 2014-01-01 [PMID: 25461272]
• Du Chenchen, Jin Mengmeng, Hong Yu et al. Downregulation of cystathionine beta-synthase/hydrogen sulfide contributes to rotenone-induced microglia polarization toward M1 type. Biochem Biophys Res Commun. 2014-08-22 [PMID: 25086357] (Mouse)
• Takano N, Sarfraz Y, Gilkes DM et al. Decreased Expression of Cystathionine b-Synthase Promotes Glioma Tumorigenesis. Mol Cancer Res. 2014-07-03 [PMID: 24994751]
• Ida T, Sawa T, Ihara H et al. Reactive cysteine persulfides and S-polythiolation regulate oxidative stress and redox signaling. Proc Natl Acad Sci U S A. 2014-04-14 [PMID: 24733942]
• Yamamoto Takehiro, Takano Naoharu, Ishiwata Kyoko et al. Reduced methylation of PFKFB3 in cancer cells shunts glucose towards the pentose phosphate pathway. Nat Commun. 2014-03-17 [PMID: 24633012] (WB, Human)
• Miyamoto Ryo, Otsuguro Ken-Ichi, Yamaguchi Soichiro, Ito Shigeo. Contribution of cysteine aminotransferase and mercaptopyruvate sulfurtransferase to hydrogen sulfide production in peripheral neurons. J Neurochem. 2014-03-27 [PMID: 24611772] (Rat)
• Takano N, Peng YJ, Kumar GK et al. Hypoxia-inducible factors regulate human and rat cystathionine b-synthase gene expression. Biochem J. 2013-12-12 [PMID: 24328859]
• Hwang SY, Sarna LK, Siow YL, O K. High fat diet stimulates hepatic cystathionine beta-synthase and cystathionine gamma-lyase expression. Canadian Journal of Physiology and Pharmacology. 2013-01-01 [PMID: 24117258]
• Teng H, Wu B, Zhao K et al. Oxygen-sensitive mitochondrial accumulation of cystathionine beta-synthase mediated by Lon protease. Proc Natl Acad Sci U S A 2013-07-30 [PMID: 23858469] (WB, Human, Mouse)
• Hu S, Xu W, Miao X et al. Sensitization of sodium channels by cystathionine b-synthetase activation in colon sensory neurons in adult rats with neonatal maternal deprivation. Exp Neurol. 2013-07-06 [PMID: 23834820]
• Zhang HH, Hu J, Zhou YL et al. Promoted Interaction of Nuclear Factor-kB with Demethylated Cystathionine-beta-Synthetase Gene Contributes to Gastric Hypersensitivity in Diabetic Rats. J Neurosci. 2013-05-22 [PMID: 23699514]
• Yang HY, Wu ZY, Wood M et al. Hydrogen sulfide attenuates opioid dependence by suppression of adenylate cyclase/cAMP pathway. Antioxid Redox Signal. 2013-05-18 [PMID: 23682813]
• Liu Y, Luo H, Liang C et al. Actions of Hydrogen Sulfide and ATP-Sensitive Potassium Channels on Colonic Hypermotility in a Rat Model of Chronic Stress. PLoS One. 2013-02-06 [PMID: 23405222]
• Shi L, Zhang HH, Xiao Y et al. Electroacupuncture Suppresses Mechanical Allodynia and Nuclear Factor Kappa B Signaling in Streptozotocin-Induced Diabetic Rats. CNS Neurosci Ther. 2012-12-11 [PMID: 23230847]
• Rashid S, Heer JK, Garle MJ et al. Hydrogen Sulphide-induced relaxation of porcine peripheral bronchioles. Br J Pharmacol. 2012-12-06 [PMID: 23215842]
• Yang G, Zhao K, Ju Y et al. Hydrogen sulfide protects against cellular senescence via S-sulfhydration of Keap1 and activation of Nrf2. Antioxid Redox Signal. 2013-02-07 [PMID: 23176571]
• Dufton N, Natividad J, Verdu EF, Wallace JL. Hydrogen sulfide and resolution of acute inflammation: A comparative study utilizing a novel fluorescent probe. Sci Rep. 2012-07-09 [PMID: 22787557]
• Qipshidze N, Metreveli N, Mishra PK et al. Hydrogen Sulfide Mitigates Cardiac Remodeling During Myocardial Infarction via Improvement of Angiogenesis Int J Biol Sci 2012-01-01 [PMID: 22419888] (WB, Mouse)
• Holwerda KM, Bos EM, Rajakumar A et al. Hydrogen sulfide producing enzymes in pregnancy and preeclampsia. Placenta. 2012-03-03 [PMID: 22391326]
• Lu YH, Huang YH, Cheng LM et al. Homocystinuria in Taiwan: An inordinately high prevalence in an Austronesian aboriginal tribe, Tao. Molecular Genetics and Metabolism. 2012-01-01 [PMID: 22353391]
• Ren YS, Wu SY, Wang XJ et al. Multiple hemodynamic effects of endogenous hydrogen sulfide on central nervous system in rats. Chin Med J. 2011-01-01 [PMID: 22340160]
• Guo H, Gai JW, Wang Y et al. Characterization of Hydrogen Sulfide and Its Synthases, Cystathionine b-Synthase and Cystathionine gamma-Lyase, in Human Prostatic Tissue and Cells. Urology. 2012-02-01 [PMID: 22310774]
• Pei Y, Wu B, Cao Q et al. Hydrogen sulfide mediates the anti-survival effect of sulforaphane on human prostate cancer cells. Toxicology and Applied Pharmacology. 2011-10-08 [PMID: 22005276]
• Streeter E, Al-Magableh M, Hart JL, Badoer E. Hydrogen Sulfide in the RVLM and PVN has No Effect on Cardiovascular Regulation. Front Physiol. 2011-09-01 [PMID: 21941511]
• Roy A, Khan AH, Islam MT et al. Interdependency of cystathione gamma-lyase and cystathione beta-synthase in hydrogen sulfide-induced blood pressure regulation in rats. Am J Hypertens. 2012-01-01 [PMID: 21866187] (WB, Rat)
• Mislanova C, Martsenyuk O, Huppertz B, Obolenskaya MY. Placental markers of folate-related metabolism in preeclampsia. Reproduction. 2011-06-20 [PMID: 21690209]
• Kasparek MS, Linden DR, Farrugia G, Sarr MG. Hydrogen sulfide modulates contractile function in rat jejunum. J Surg Res. 2012-06-15 [PMID: 21571312] (ICC/IF, Rat)
• Yamamoto T, Takano N, Ishiwata K, Suematsu M. Carbon monoxide stimulates global protein methylation via its inhibitory action on cystathionine beta-synthase. J. 2010-11-10 [PMID: 21297920]
• Predmore BL, Alendy MJ, Ahmed KI et al. The hydrogen sulfide signaling system: changes during aging and the benefits of caloric restriction. Age (Dordr). 2010-05-26 [PMID: 20502969]
• Majtan T, Liu L, Carpenter JF, Kraus JP. Rescue of cystathionine beta-synthase (CBS) mutants with chemical chaperones: purification and characterization of eight CBS mutant enzymes. J Biol Chem. 2010-03-22 [PMID: 20308073]
• Li Q, Sun B, Wang X et al. A crucial role for hydrogen sulfide in oxygen sensing via modulating large conductance calcium-activated potassium channels. Antioxid Redox Signal;12(10):1179-89. 2010-05-15 [PMID: 19803741]
• Hennig B, Diener M. Actions of hydrogen sulphide on ion transport across rat distal colon. Br J Pharmacol;158(5):1263-75. 2009-11-01 [PMID: 19785650]
• Xu, GY, Winston, JH, Shenoy, M. The endogenous hydrogen sulfide producing enzyme cystathionine-beta synthase contributes to visceral hypersensitivity in a rat model of irritable bowel syndrome. Mol Pain;5:44. 2009-08-06 [PMID: 19660142]
• Lee M, Schwab C, Yu S et al. Astrocytes produce the antiinflammatory and neuroprotective agent hydrogen sulfide. Neurobiol Aging;30(10):1523-34. 2009-10-01 [PMID: 19631409]
• Martin GR, McKnight GW, Dicay MS et al. Hydrogen sulphide synthesis in the rat mouse gastrointestinal tract. Dig Liver Dis. 2009-06-29 [PMID: 19570733]
• Wallace JL, Vong L, McKnight W et al. Endogenous and Exogenous Hydrogen Sulfide Promotes Resolution of Colitis in Rats. Gastroenterology. 2009-04-15 [PMID: 19375422]
• Majtan T, Singh LR, Wang L et al. Active CBS can be expressed in heme-free systems in the presence of metal-substituted porphyrins or a chemical chaperone. J Biol Chem;283(50):34588-95. 2008-12-12 [PMID: 18849566]
• Sen, U, N Tyagi et al (2007). Cystathionine {beta}-synthase gene transfer 3-Deazaadenosine ameliorate inflammatory response in endothelial cells. Am J Physiol Cell Physiol;293(6):C1779-87. 2007-12-01 [PMID: 17855772]
• Wallace JL, Dicay M, McKnight W et al. Hydrogen sulfide enhances ulcer healing in rats. FASEB J;21(14):4070-6. 2007-12-01 [PMID: 17634391]
• Schicho R, Krueger D, Zeller F et al. Hydrogen sulfide is a novel prosecretory neuromodulator in the Guinea-pig human colon. Gastroenterology;131(5):1542-52. 2006-11-01 [PMID: 17101327]
• Dai J, Sullivan BA, Higgins JM et al. Regulation of mitotic chromosome cohesion by Haspin and Aurora B. Dev Cell 2006-11-01 [PMID: 17084365]

Review for CBS Antibody (H00000875-M01) (1)

Average Rating: 3

(Based on 1 review)

We have 1 review tested in 1 species: Mouse.

reviewed by: Verified Customer WB Mouse 02/02/2010

Summary

• Application: Western Blot
• Sample Tested: Mouse Liver and Lung Tissue, Sample Amount: 15 ug
• Species: Mouse
• Lot: 09258-3E1

FAQs for CBS Antibody (H00000875-M01). (Showing 1 - 2 of 2 FAQs).

1. We would like to check on Cystathionine beta synthase # H00000875-M01. We need a mouse monoclonal. Applications: Immunoblotting, IHC May I know if this can cross-react with mouse CBS? Because we are actually probing this enzyme in a mouse cell line / tissue and the species is human, host is mouse.
   • This antibody has never been tested against mouse samples so we don't know if it will cross react. I recommend checking with a blast against the mouse protein to find out how similar the immunogen is to the mouse protein. If it is 80% homologous or higher typically there is a good chance it might react. In addition to using an anti-mouse secondary will bind non-specifically to their mouse tissues, and most likely cause high background. Running a secondary only control would be advised or even better increase the concentration of the primary on their samples and use a directly conjugated version to avoid non-specific secondary binding. In this case we can recommend our Innovators Reward Program. Our Innovator's Reward is offered to reward researchers for testing new species and applications with our products. If testing on this antibody is performed on an untested species and/or application, and the results are shared, then the antibody is eligible for the Innovator's Reward. Under this program, Novus will provide you a credit of equal or lesser value on a future product of equal value in exchange for your new data in the form of an online review. The great thing is you are eligible even if the antibody doesn't work because the data is still useful to us.
2. I was wondering if the CBS Antibody (3E1) (H00000875-M01) has been used for immunofluorescence on monolayer cell cultures?
   • Unfortunately it has never been tested for immunofluorescence in an ICC application on cells. Since it stains tissue, I would imagine it should be capable of staining cells as well. Without testing we cannot guarantee this, but if you want to test using our Innovators Reward Program to save some money for providing feedback that is an option for you. Here are the details: If you would like to test this antibody in an untested species and/or application and share your results with us, then I can recommend our Innovators Reward program. Under this program, Novus will provide you a 50% refund on the purchased product as well as a 50% discount on a future product of equal value in exchange for your new data. The great thing is you are eligible regardless if you get positive results or not.

Bioinformatics

• Gene Symbol: CBS
• Entrez:
  • 875(Human)
• OMIM:
  • 236200(Human)
• Uniprot:
  • NP_000062(Human)