CBR3 Antibody

Images

 
Western Blot: CBR3 Antibody [NBP1-87065] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: CBR3 Antibody [NBP1-87065] - Staining of human cell line U-251MG shows positivity in nucleus but not nucleoli and cytoplasm.
Immunohistochemistry-Paraffin: CBR3 Antibody [NBP1-87065] - Staining of human lymph node shows strong cytoplasmic and nuclear positivity in lymphocytes outside reaction center cells.
Western Blot: CBR3 Antibody [NBP1-87065] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CBR3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DDPMPFDIKAEMTLKTNFFATRNMCNELLPIMKPHGRVVNISSLQCLRAFENCSEDLQERFHSETLTEGDLVDLMK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CBR3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
CBR3 Protein (NBP1-87065PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for CBR3 Antibody

  • carbonyl reductase (NADPH) 3
  • carbonyl reductase (NADPH) 3, EC 1.1.1.18410EC 1.1.1
  • carbonyl reductase [NADPH] 3
  • carbonyl reductase 3
  • EC 1.1.1.184
  • hCBR3
  • NADPH-dependent carbonyl reductase 3
  • SDR21C2
  • short chain dehydrogenase/reductase family 21C, member 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86595
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
H00002551-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
NB200-209
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-85338
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-44090
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-30446
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83323
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
NBP1-82235
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-46466
Species: Hu
Applications: IHC
AF847
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NB600-225
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-03319
Species: Hu, Mu, Rt, Mk
Applications: WB, Flow, IHC, IHC-P
NBP1-87065
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CBR3 Antibody (NBP1-87065) (0)

There are no publications for CBR3 Antibody (NBP1-87065).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CBR3 Antibody (NBP1-87065) (0)

There are no reviews for CBR3 Antibody (NBP1-87065). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CBR3 Antibody (NBP1-87065) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CBR3 Products

Bioinformatics Tool for CBR3 Antibody (NBP1-87065)

Discover related pathways, diseases and genes to CBR3 Antibody (NBP1-87065). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CBR3 Antibody (NBP1-87065)

Discover more about diseases related to CBR3 Antibody (NBP1-87065).
 

Pathways for CBR3 Antibody (NBP1-87065)

View related products by pathway.

PTMs for CBR3 Antibody (NBP1-87065)

Learn more about PTMs related to CBR3 Antibody (NBP1-87065).
 

Research Areas for CBR3 Antibody (NBP1-87065)

Find related products by research area.

Blogs on CBR3

There are no specific blogs for CBR3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CBR3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CBR3