CBR1 Antibody - BSA Free

Western Blot: CBR1 Antibody [NBP1-52871] - OVCAR-3 cell lysate, concentration 0.2-1 ug/ml.

Immunohistochemistry-Paraffin: CBR1 Antibody [NBP1-52871] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Cytoplasmic Primary Antibody Concentration: N/A Other Working Concentrations: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

CBR1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to CBR1(carbonyl reductase 1) The peptide sequence was selected form the middle region of CBR1. Peptide sequence AEVTMKTNFFGTRDVCTELLPLIKPQGRVVNVSSIMSVRALKSCSPELQQ. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CBR1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for CBR1 Antibody - BSA Free

• 15-hydroxyprostaglandin dehydrogenase [NADP+]
• carbonyl reductase (NADPH) 1
• carbonyl reductase (NADPH) 1, EC 1.1.1.18410EC 1.1.1.197,15-hydroxyprostaglandin dehydrogenase
• carbonyl reductase [NADPH] 1
• carbonyl reductase 1
• CBR
• CRN
• EC 1.1.1.184
• EC 1.1.1.189
• hCBR1
• NADPH-dependent carbonyl reductase 1
• Prostaglandin 9-ketoreductase
• Prostaglandin-E(2) 9-reductase
• SDR21C1
• short chain dehydrogenase/reductase family 21C, member 1

Background

Carbonyl reductase is one of several monomeric, NADPH-dependent oxidoreductases having wide specificity for carbonyl compounds. This enzyme is widely distributed in human tissues.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CBR1
• OMIM:
  • NP_001748(Human)
• Uniprot:
  • P16152(Human)