Recombinant Human CBP/KAT3A Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human CBP/KAT3A Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 951-1050 of Human CBP/KAT3A

Source: Wheat Germ

Amino Acid Sequence: PVHAQPPGTPLSQAAASIDNRVPTPSSVASAETNSQQPGPDVPVLEMKTETQAEDTEPDPGESKGEPRSEMMEEDLQGASQVKEETDIAEQKSEPMEVDE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
CREBBP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CBP/KAT3A Protein

  • CBP
  • CBPRTS
  • CREB binding protein
  • CREB-binding protein
  • CREBBP
  • EC 2.3.1.48
  • KAT3A
  • RSTS
  • RTS
  • Rubinstein-Taybi syndrome

Background

CREBBP - CREB binding protein (Rubinstein-Taybi syndrome)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NB100-410
Species: Hu, Mu
Applications: WB, IP
H00008850-M04
Species: Hu
Applications: WB, ELISA, ICC/IF
NB200-310
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-314
Species: Hu
Applications: WB, IP, PLA
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, ICC, KO
NB100-56583
Species: Hu
Applications: WB, Flow, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
NB100-56530
Species: Hu
Applications: WB
H00001387-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for CBP/KAT3A Partial Recombinant Protein (H00001387-Q01) (0)

There are no publications for CBP/KAT3A Partial Recombinant Protein (H00001387-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CBP/KAT3A Partial Recombinant Protein (H00001387-Q01) (0)

There are no reviews for CBP/KAT3A Partial Recombinant Protein (H00001387-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CBP/KAT3A Partial Recombinant Protein (H00001387-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CBP/KAT3A Products

Bioinformatics Tool for CBP/KAT3A Partial Recombinant Protein (H00001387-Q01)

Discover related pathways, diseases and genes to CBP/KAT3A Partial Recombinant Protein (H00001387-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CBP/KAT3A Partial Recombinant Protein (H00001387-Q01)

Discover more about diseases related to CBP/KAT3A Partial Recombinant Protein (H00001387-Q01).
 

Pathways for CBP/KAT3A Partial Recombinant Protein (H00001387-Q01)

View related products by pathway.

PTMs for CBP/KAT3A Partial Recombinant Protein (H00001387-Q01)

Learn more about PTMs related to CBP/KAT3A Partial Recombinant Protein (H00001387-Q01).
 

Research Areas for CBP/KAT3A Partial Recombinant Protein (H00001387-Q01)

Find related products by research area.

Blogs on CBP/KAT3A

There are no specific blogs for CBP/KAT3A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CBP/KAT3A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CREBBP
Entrez