CBP/KAT3A Antibody (2H5)

Images

 
Immunocytochemistry/ Immunofluorescence: CBP/KAT3A Antibody (2H5) [H00001387-M01] - Analysis of monoclonal antibody to CREBBP on HeLa cell. Antibody concentration 10 ug/ml.
Proximity Ligation Assay: CBP/KAT3A Antibody (2H5) [H00001387-M01] - Protein-protein interactions between FGFR1 and CREBBP HeLa cells were stained with anti-FGFR1 (H00002260-D01P) rabbit purified polyclonal 1:1200 and ...read more
Sandwich ELISA: CBP/KAT3A Antibody (2H5) [H00001387-M01] - Detection limit for recombinant GST tagged CREBBP is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, PLA
Clone
2H5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CBP/KAT3A Antibody (2H5) Summary

Immunogen
CREBBP (NP_004371 951 a.a. - 1050 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PVHAQPPGTPLSQAAASIDNRVPTPSSVASAETNSQQPGPDVPVLEMKTETQAEDTEPDPGESKGEPRSEMMEEDLQGASQVKEETDIAEQKSEPMEVDE
Specificity
CREBBP - CREB binding protein (Rubinstein-Taybi syndrome)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CREBBP
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Proximity Ligation Assay
Application Notes
Antibody reactivity against recombinant protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. It has been use for IF.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CBP/KAT3A Antibody (2H5)

  • CBP
  • CBPRTS
  • CREB binding protein
  • CREB-binding protein
  • CREBBP
  • EC 2.3.1.48
  • KAT3A
  • RSTS
  • RTS
  • Rubinstein-Taybi syndrome

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NB100-410
Species: Hu, Mu
Applications: WB, IP
H00008850-M04
Species: Hu
Applications: WB, ELISA, ICC/IF
NB200-310
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-314
Species: Hu
Applications: WB, IP, PLA
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-91499
Species: Mu, Bv
Applications: WB, ICC/IF, IHC
NB100-56530
Species: Hu
Applications: WB
H00001387-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, PLA

Publications for CBP/KAT3A Antibody (H00001387-M01) (0)

There are no publications for CBP/KAT3A Antibody (H00001387-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CBP/KAT3A Antibody (H00001387-M01) (0)

There are no reviews for CBP/KAT3A Antibody (H00001387-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CBP/KAT3A Antibody (H00001387-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CBP/KAT3A Products

Bioinformatics Tool for CBP/KAT3A Antibody (H00001387-M01)

Discover related pathways, diseases and genes to CBP/KAT3A Antibody (H00001387-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CBP/KAT3A Antibody (H00001387-M01)

Discover more about diseases related to CBP/KAT3A Antibody (H00001387-M01).
 

Pathways for CBP/KAT3A Antibody (H00001387-M01)

View related products by pathway.

PTMs for CBP/KAT3A Antibody (H00001387-M01)

Learn more about PTMs related to CBP/KAT3A Antibody (H00001387-M01).
 

Research Areas for CBP/KAT3A Antibody (H00001387-M01)

Find related products by research area.

Blogs on CBP/KAT3A

There are no specific blogs for CBP/KAT3A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CBP/KAT3A Antibody (2H5) and receive a gift card or discount.

Bioinformatics

Gene Symbol CREBBP
Entrez
Uniprot