CBLL1 Antibody - BSA Free

Immunohistochemistry-Paraffin: CBLL1 Antibody [NBP1-83589] - Staining of human cerebellum, liver, placenta and testis using Anti-CBLL1 antibody NBP1-83589 (A) shows similar protein distribution across tissues to independent antibody NBP1-83588 (B).

Immunohistochemistry-Paraffin: CBLL1 Antibody [NBP1-83589] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: CBLL1 Antibody [NBP1-83589] - Staining of human cerebellum shows strong nuclear positivity in all layers.

Immunohistochemistry-Paraffin: CBLL1 Antibody [NBP1-83589] - Staining of human liver shows very weak positivity in hepatocytes as expected.

Immunohistochemistry-Paraffin: CBLL1 Antibody [NBP1-83589] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CBLL1 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RKHSNLITVPIQDDSNSGAREPPPPAPAPAHHHPEYQGQPVVSHPHHIMPPQQHYAPPPPPPPPISHPMP
• Predicted Species: Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CBLL1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  CBLL1 Protein (NBP1-83589PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for CBLL1 Antibody - BSA Free

• Cas-Br-M (murine) ecotropic retroviral transforming sequence-like 1
• Casitas B-lineage lymphoma-transforming sequence-like protein 1
• c-Cbl-like protein 1
• E3 ubiquitin-protein ligase Hakai
• EC 6.3.2
• EC 6.3.2.-
• E-cadherin binding protein E7
• HAKAIRNF188FLJ23109
• MGC163401
• MGC163403
• RING finger protein 188

Background

Epithelial cell cadherin (CDH1; MIM 192090) is endocytosed as a consequence of tyrosine phosphorylation and ubiquitination. HAKAI is an E3 ubiquitin ligase (see UBE3A; MIM 601623) that mediates ubiquitination of the CDH1 complex.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CBLL1 Antibody (NBP1-83589)(1)

Publication using NBP1-83589

• Lothion-Roy J, Haigh DB, Harris AE et al. Clinical and molecular significance of the RNA m(6)A methyltransferase complex in prostate cancer Frontiers in Genetics 2023-01-12 [PMID: 36733939]

Bioinformatics

• Gene Symbol: CBLL1