CBFA2T3 Antibody - BSA Free

Western Blot: CBFA2T3 Antibody [NBP3-35460] - Western Blot analysis of various lysates using CBFA2T3 Rabbit pAb at 1:900 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates / proteins: 25 ug per lane. Blocking buffer: 3 % nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

CBFA2T3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit CBFA2T3 Antibody - BSA Free (NBP3-35460) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 593-653 of human CBFA2T3 (NP_005178.4).
  
  Sequence:
  DRDPLHPEHLSKRPCTLNPAQRYSPSNGPPQPTPPPHYRLEDIAMAHHFRDAYRHPDPRELRERHRPLVVPGSRQEEVIDHKLTER
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CBFA2T3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:100 - 1:500
• Theoretical MW: 71 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for CBFA2T3 Antibody - BSA Free

• core-binding factor, runt domain, alpha subunit 2; translocated to, 3
• hMTG16
• MTG16ETO2
• MTG8-related protein 2
• MTGR2MTG8-related gene 2
• Myeloid translocation gene on chromosome 16 protein
• protein CBFA2T3
• Zinc finger MYND domain-containing protein 4
• ZMYND4myeloid translocation gene 8 and 16b

Background

The t(16;21)(q24;q22) translocation is a rare but recurrent chromosomal abnormality associated with therapy-related myeloid malignancies. The translocation produces a chimeric gene made up of the 5'-region of the AML1 gene fused to the 3'-region of this gene. In addition, this gene is a putative breast tumor suppressor. Two transcript variants encoding different isoforms have been found for this gene, and a brefeldin A-sensitive association of RII-alpha protein with one of the isoforms has been demonstrated in the Golgi apparatus. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CBFA2T3