CBF1-interacting corepressor Antibody (2E11) - Azide and BSA Free

Western Blot: CBF1-interacting corepressor Antibody (2E11) [H00009541-M01] - CIR monoclonal antibody (M01), clone 2E11. Analysis of CIR expression in HeLa.

Sandwich ELISA: CBF1-interacting corepressor Antibody (2E11) [H00009541-M01] - Detection limit for recombinant GST tagged CIR is 0.03 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 2E11
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

CBF1-interacting corepressor Antibody (2E11) - Azide and BSA Free Summary

• Immunogen: CIR (NP_004873, 136 a.a. ~ 204 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HVNTDRECPLFGLSGINASSVPTDGSGPSMHPSELIAEMRNSGFALKRNVLGRNLTANDPSQEYVASEG
• Specificity: Reacts with CBF1 interacting corepressor.
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CIR1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot
• Application Notes: This antibody is reactive against cell lysate in western blot and recombinant protein in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CBF1-interacting corepressor Antibody (2E11) - Azide and BSA Free

• CBF1 interacting corepressor
• CBF1-interacting corepressor
• CIRrecepin
• corepressor interacting with RBPJ 1
• corepressor interacting with RBPJ, 1
• Recepin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CIR1
• Entrez:
  • 9541(Human)
• Uniprot:
  • NP_004873(Human)