CBF1-interacting corepressor Antibody (2E11)

Images

 
Western Blot: CBF1-interacting corepressor Antibody (2E11) [H00009541-M01] - CIR monoclonal antibody (M01), clone 2E11. Analysis of CIR expression in HeLa.
Sandwich ELISA: CBF1-interacting corepressor Antibody (2E11) [H00009541-M01] - Detection limit for recombinant GST tagged CIR is 0.03 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
2E11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CBF1-interacting corepressor Antibody (2E11) Summary

Immunogen
CIR (NP_004873, 136 a.a. ~ 204 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. HVNTDRECPLFGLSGINASSVPTDGSGPSMHPSELIAEMRNSGFALKRNVLGRNLTANDPSQEYVASEG
Specificity
Reacts with CBF1 interacting corepressor.
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CIR1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot
Application Notes
This antibody is reactive against cell lysate in western blot and recombinant protein in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CBF1-interacting corepressor Antibody (2E11)

  • CBF1 interacting corepressor
  • CBF1-interacting corepressor
  • CIRrecepin
  • corepressor interacting with RBPJ 1
  • corepressor interacting with RBPJ, 1
  • Recepin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP2-01702
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-33427
Species: Hu
Applications: ChIP, ICC/IF, WB
NBP1-85630
Species: Hu
Applications: IHC, IHC-P, WB
8184-CK
Species: Hu
Applications: EnzAct
202-IL
Species: Hu
Applications: BA
NBP3-05061
Species: Hu, Mu
Applications: ICC/IF, WB
1129-ER
Species: Hu
Applications: BA
NBP2-76943
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF6989
Species: Mu
Applications: IHC
H00342184-M07
Species: Hu
Applications: ELISA, ICC/IF, WB
AF2065
Species: Mu
Applications: ICC, IHC, Simple Western, WB
AF3059
Species: Mu
Applications: ICC, Simple Western, WB
DMF00B
Species: Hu
Applications: ELISA
D6050
Species: Hu
Applications: ELISA
210-TA
Species: Hu
Applications: BA
MAB342
Species: Hu
Applications: AgAct, ICC, WB
NBP2-67599
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB

Publications for CBF1-interacting corepressor Antibody (H00009541-M01) (0)

There are no publications for CBF1-interacting corepressor Antibody (H00009541-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CBF1-interacting corepressor Antibody (H00009541-M01) (0)

There are no reviews for CBF1-interacting corepressor Antibody (H00009541-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CBF1-interacting corepressor Antibody (H00009541-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CBF1-interacting corepressor Products

Bioinformatics Tool for CBF1-interacting corepressor Antibody (H00009541-M01)

Discover related pathways, diseases and genes to CBF1-interacting corepressor Antibody (H00009541-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CBF1-interacting corepressor Antibody (H00009541-M01)

Discover more about diseases related to CBF1-interacting corepressor Antibody (H00009541-M01).
 

Pathways for CBF1-interacting corepressor Antibody (H00009541-M01)

View related products by pathway.

PTMs for CBF1-interacting corepressor Antibody (H00009541-M01)

Learn more about PTMs related to CBF1-interacting corepressor Antibody (H00009541-M01).
 

Research Areas for CBF1-interacting corepressor Antibody (H00009541-M01)

Find related products by research area.

Blogs on CBF1-interacting corepressor

There are no specific blogs for CBF1-interacting corepressor, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CBF1-interacting corepressor Antibody (2E11) and receive a gift card or discount.

Bioinformatics

Gene Symbol CIR1
Entrez
Uniprot