Cathepsin W Antibody (4A8)

Images

 
Sandwich ELISA: Cathepsin W Antibody (4A8) [H00001521-M01] - Detection limit for recombinant GST tagged CTSW is approximately 3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4A8
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Cathepsin W Antibody (4A8) Summary

Immunogen
CTSW (AAH48255, 22 a.a. - 376 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. IRGPLRAQDLGPQPLELKEAFKLFQIQFNRSYLSPEEHAHRLDIFAHNLAQAQRLQEEDLGTAEFGVTPFSDLTEEEFGQLYGYRRAAGGVPSMGREIRSEEPEESVPFSCDWRKVAGAISPIKDQKNCNCCWAMAAAGNIETLWRISFWDFVDVSVQELLDCGRCGDGCHGGFVWDAFITVLNNSGLASEKDYPFQGKVRAHRCHPKKYQKVAWIQDFIMLQNNEHRIAQYLATYGPITVTINMKPLQLYRKGVIKATPTTCDPQLVDHSVLLVGFGSVKSEEGIWAETVSSQSQPQPPHPTPYWILKNSWGAQWGEKGYFRLHRGSNTCGITKFPLTARVQKPDMKPRVSCPP
Localization
Endoplasmic reticulum
Specificity
CTSW - cathepsin W (lymphopain)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CTSW
Purity
Ascites
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Ascites

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cathepsin W Antibody (4A8)

  • cathepsin W (lymphopain)
  • cathepsin W
  • EC 3.4.22.-
  • lymphopain
  • LYPN

Background

The protein encoded by this gene, a member of the peptidase C1 family, is a cysteine proteinase that may have a specific function in the mechanism or regulation of T-cell cytolytic activity. The encoded protein is found associated with the membrane inside the endoplasmic reticulum of natural killer and cytotoxic T-cells. Expression of this gene is up-regulated by interleukin-2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2075
Species: Hu
Applications: WB, IHC, IP
AF952
Species: Hu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
H00001513-M01
Species: Hu
Applications: WB, ELISA, IHC-P
AF953
Species: Hu
Applications: WB, Simple Western, IHC, IP
AF1034
Species: Mu, Rt
Applications: WB, Simple Western, IHC
AF382
Species: Hu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, Neut
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-77397
Species: Hu, Mu, Rt, Ha, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P
NBP1-88527
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
MAB29051
Species: Hu
Applications: IP, CyTOF-ready, ICC, ICFlow
NBP2-15104
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5866
Species: Hu
Applications: WB, IHC
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88526
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15184
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
H00001521-M01
Species: Hu
Applications: WB, ELISA

Publications for Cathepsin W Antibody (H00001521-M01) (0)

There are no publications for Cathepsin W Antibody (H00001521-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cathepsin W Antibody (H00001521-M01) (0)

There are no reviews for Cathepsin W Antibody (H00001521-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cathepsin W Antibody (H00001521-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cathepsin W Products

Bioinformatics Tool for Cathepsin W Antibody (H00001521-M01)

Discover related pathways, diseases and genes to Cathepsin W Antibody (H00001521-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cathepsin W Antibody (H00001521-M01)

Discover more about diseases related to Cathepsin W Antibody (H00001521-M01).
 

Pathways for Cathepsin W Antibody (H00001521-M01)

View related products by pathway.

PTMs for Cathepsin W Antibody (H00001521-M01)

Learn more about PTMs related to Cathepsin W Antibody (H00001521-M01).

Blogs on Cathepsin W

There are no specific blogs for Cathepsin W, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cathepsin W Antibody (4A8) and receive a gift card or discount.

Bioinformatics

Gene Symbol CTSW
Entrez
OMIM
Uniprot