Cathepsin C/DPPI Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Cathepsin C/DPPI. Source: E. coli Amino Acid Sequence: MLEARIRILTNNSQTPILSPQEVVSCSQYAQGCEGGFPYLIAGKYAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSS Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
CTSC |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57844. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Cathepsin C/DPPI Recombinant Protein Antigen
Background
DPP1 is encoded by this gene, a member of the peptidase C1 family, is a lysosomal cysteine proteinase that appears to be a central coordinator for activation of many serine proteinases in immune/inflammatory cells. It is composed of a dimer of disulfide-linked heavy and light chains, both produced from a single protein precursor, and a residual portion of the propeptide acts as an intramolecular chaperone for the folding and stabilization of the mature enzyme. This enzyme requires chloride ions for activity and can degrade glucagon. Defects in the encoded protein have been shown to be a cause of Papillon-Lefevre syndrome, an autosomal recessive disorder characterized by palmoplantar keratosis and periodontitis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Ch, Hu, Mu, Rb, Rt, Sh
Applications: B/N, Flow, ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: IHC, Neut, WB
Species: Hu
Applications: CyTOF-ready, ICFlow
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Bv, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, WB
Species: Mu, Rt
Applications: ICC/IF, WB
Species: Hu
Applications: ICC, IHC, Simple Western, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Mu
Applications: IP, Neut, WB
Publications for Cathepsin C/DPPI Recombinant Protein Antigen (NBP2-57844PEP) (0)
There are no publications for Cathepsin C/DPPI Recombinant Protein Antigen (NBP2-57844PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Cathepsin C/DPPI Recombinant Protein Antigen (NBP2-57844PEP) (0)
There are no reviews for Cathepsin C/DPPI Recombinant Protein Antigen (NBP2-57844PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Cathepsin C/DPPI Recombinant Protein Antigen (NBP2-57844PEP) (0)
Additional Cathepsin C/DPPI Products
Research Areas for Cathepsin C/DPPI Recombinant Protein Antigen (NBP2-57844PEP)
Find related products by research area.
|
Blogs on Cathepsin C/DPPI