Cathepsin C/DPPI Recombinant Protein Antigen

Images

 
There are currently no images for Cathepsin C/DPPI Recombinant Protein Antigen (NBP2-55936PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Cathepsin C/DPPI Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Cathepsin C/DPPI.

Source: E. coli

Amino Acid Sequence: SQEKYSNRLYKYDHNFVKAINAIQKSWTATTYMEYETLTLGDMIRRSGGHSRKIPRPKPAPLT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CTSC
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55936.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Cathepsin C/DPPI Recombinant Protein Antigen

  • Cathepsin C
  • cathepsin CEC 3.4.14.1
  • Cathepsin J
  • CPPIHMS
  • CTSC
  • dipeptidyl peptidase 1
  • Dipeptidyl peptidase I
  • Dipeptidyl transferase
  • dipeptidyl-peptidase I
  • DPP1
  • DPPI
  • DPP-I
  • JP
  • JPD
  • PALS
  • PLS

Background

DPP1 is encoded by this gene, a member of the peptidase C1 family, is a lysosomal cysteine proteinase that appears to be a central coordinator for activation of many serine proteinases in immune/inflammatory cells. It is composed of a dimer of disulfide-linked heavy and light chains, both produced from a single protein precursor, and a residual portion of the propeptide acts as an intramolecular chaperone for the folding and stabilization of the mature enzyme. This enzyme requires chloride ions for activity and can degrade glucagon. Defects in the encoded protein have been shown to be a cause of Papillon-Lefevre syndrome, an autosomal recessive disorder characterized by palmoplantar keratosis and periodontitis. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92190
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
NB100-1481
Species: Hu
Applications: PEP-ELISA, WB
NB300-562
Species: Ch, Hu, Mu, Rb, Rt, Sh
Applications: B/N, Flow, ICC/IF, IHC,  IHC-P, WB
AF965
Species: Mu
Applications: IHC, Neut, WB
MAB7330
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP2-21792
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-31661
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-33498
Species: Hu
Applications: IHC,  IHC-P
AF2340
Species: Hu
Applications: CyTOF-ready, Flow, IP, WB
AF3749
Species: Hu
Applications: IHC, WB
DY4517-05
Species: Mu
Applications: ELISA
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
H00009242-M01
Species: Hu
Applications: ELISA, WB
NB100-74503
Species: Mu, Rt
Applications: ICC/IF, WB
AF1180
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP1-25966
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF3436
Species: Mu
Applications: IP, Neut, WB

Publications for Cathepsin C/DPPI Recombinant Protein Antigen (NBP2-55936PEP) (0)

There are no publications for Cathepsin C/DPPI Recombinant Protein Antigen (NBP2-55936PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cathepsin C/DPPI Recombinant Protein Antigen (NBP2-55936PEP) (0)

There are no reviews for Cathepsin C/DPPI Recombinant Protein Antigen (NBP2-55936PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Cathepsin C/DPPI Recombinant Protein Antigen (NBP2-55936PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cathepsin C/DPPI Products

Research Areas for Cathepsin C/DPPI Recombinant Protein Antigen (NBP2-55936PEP)

Find related products by research area.

Blogs on Cathepsin C/DPPI

There are no specific blogs for Cathepsin C/DPPI, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Cathepsin C/DPPI Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CTSC