Cathepsin C/DPPI Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Cathepsin C/DPPI Antibody [NBP2-57844] - Staining of human cell line U-2 OS shows localization to nucleoplasm & vesicles.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cathepsin C/DPPI Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MLEARIRILTNNSQTPILSPQEVVSCSQYAQGCEGGFPYLIAGKYAQDFGLVEEACFPYTGTDSPCKMKEDCFRYYSS
Specificity
Specificity of human Cathepsin C/DPPI antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CTSC
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Cathepsin C/DPPI Recombinant Protein Antigen (NBP2-57844PEP)

Reactivity Notes

Mouse 87%, Rat 88%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Cathepsin C/DPPI Antibody

  • Cathepsin C
  • cathepsin CEC 3.4.14.1
  • Cathepsin J
  • CPPIHMS
  • CTSC
  • dipeptidyl peptidase 1
  • Dipeptidyl peptidase I
  • Dipeptidyl transferase
  • dipeptidyl-peptidase I
  • DPP1
  • DPPI
  • DPP-I
  • JP
  • JPD
  • PALS
  • PLS

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92190
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-1481
Species: Hu
Applications: WB, PEP-ELISA
NB300-562
Species: Hu, Mu, Rt, Ch, Rb, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, B/N
AF953
Species: Hu
Applications: WB, Simple Western, IHC, IP, KO
MAB7330
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP2-21792
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-31661
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33498
Species: Hu
Applications: IHC, IHC-P
AF2340
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
AF3749
Species: Hu
Applications: WB, IHC
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NB100-1533
Species: Hu, Mu, Rt, Po, Sh
Applications: WB, Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
MAB9521
Species: Hu, Mu
Applications: WB, IHC, IP
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP2-56244
Species: Hu
Applications: WB, ICC/IF
NBP1-87781
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF1180
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP1-25966
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84986
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57844
Species: Hu
Applications: ICC/IF

Publications for Cathepsin C/DPPI Antibody (NBP2-57844) (0)

There are no publications for Cathepsin C/DPPI Antibody (NBP2-57844).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cathepsin C/DPPI Antibody (NBP2-57844) (0)

There are no reviews for Cathepsin C/DPPI Antibody (NBP2-57844). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Cathepsin C/DPPI Antibody (NBP2-57844) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Cathepsin C/DPPI Products

Bioinformatics Tool for Cathepsin C/DPPI Antibody (NBP2-57844)

Discover related pathways, diseases and genes to Cathepsin C/DPPI Antibody (NBP2-57844). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cathepsin C/DPPI Antibody (NBP2-57844)

Discover more about diseases related to Cathepsin C/DPPI Antibody (NBP2-57844).
 

Pathways for Cathepsin C/DPPI Antibody (NBP2-57844)

View related products by pathway.

PTMs for Cathepsin C/DPPI Antibody (NBP2-57844)

Learn more about PTMs related to Cathepsin C/DPPI Antibody (NBP2-57844).
 

Research Areas for Cathepsin C/DPPI Antibody (NBP2-57844)

Find related products by research area.

Blogs on Cathepsin C/DPPI

There are no specific blogs for Cathepsin C/DPPI, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cathepsin C/DPPI Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CTSC