Cathepsin B Recombinant Protein Antigen

Images

 
There are currently no images for Cathepsin B Protein (NBP1-86048PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Cathepsin B Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CTSB.

Source: E. coli

Amino Acid Sequence: DELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CTSB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86048.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Cathepsin B Recombinant Protein Antigen

  • APP secretase
  • APPS
  • Cathepsin B
  • Cathepsin B1
  • CPSBamyloid precursor protein secretase
  • CTSB
  • cysteine protease
  • EC 3.4.22
  • EC 3.4.22.1

Background

The cathepsin family of proteolytic enzymes contains several diverse classes of proteases. The cysteine protease class comprises cathepsins B, L, H, K, S and O. The aspartyl protease class is composed of cathepsins D and E. cathepsin G is in the serine protease class. Most cathepsins are lysosomal and each is involved in cellular metabolism, participating in various events such as peptide biosynthesis and protein degradation. cathepsin B is expressed in luminal epithelial cells, indicating that cathepsin B is a marker for secretory cell death.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1029
Species: Mu
Applications: ICC, IHC, IP, WB
AF1013
Species: Mu
Applications: IHC, IP, WB
MSCTC0
Species: Mu, Rt
Applications: ELISA
H00001513-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF1183
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, Neut, WB
AF1286
Species: Hu
Applications: IHC, IP, Simple Western, WB
NB600-930
Species: Hu, Rt
Applications: ELISA, WB
AF1034
Species: Mu, Rt
Applications: IHC, Simple Western, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-12446
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IM, IP, KD, WB
DY4517-05
Species: Mu
Applications: ELISA
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC

Publications for Cathepsin B Protein (NBP1-86048PEP) (0)

There are no publications for Cathepsin B Protein (NBP1-86048PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cathepsin B Protein (NBP1-86048PEP) (0)

There are no reviews for Cathepsin B Protein (NBP1-86048PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Cathepsin B Protein (NBP1-86048PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cathepsin B Products

Research Areas for Cathepsin B Protein (NBP1-86048PEP)

Find related products by research area.

Blogs on Cathepsin B.

Cathepsin B - a lysosomal protease with potential of an important drug target in neurological diseases and cancer
Cathepsins are a family of lysosomal proteases (serine, aspartic and cysteine proteases) that acts in conjunction with lipases and nucleases to degrade biological macromolecules in the lysosomes (1). While most cathepsins are ubiquitously expressed...  Read full blog post.

Caspase 11: A novel non-canonical inflammasomes
Cell death via apoptosis is a key cellular function triggered by the cell death receptor family and their ligands. This regulated process then transmits downstream signals through adaptor molecules ending with the caspase cysteine proteases. Caspas...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Cathepsin B Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CTSB