Catenin alpha 2 Antibody - BSA Free

Western Blot: Catenin alpha 2 Antibody [NBP2-88777] - Host: Rabbit. Target Name: CTNNA2. Sample Type: PANC1 Whole cell lysates. Antibody Dilution: 1.0ug/mlCTNNA2 is supported by BioGPS gene expression data to be expressed in PANC1

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Catenin alpha 2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Catenin alpha 2 Antibody - BSA Free (NBP2-88777) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human Catenin alpha 2. Peptide sequence: YQKVYGTAAVNSPVVSWKMKAPEKKPLVKREKPEEFQTRVRRGSQKKHIS The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CTNNA2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Catenin alpha 2 Antibody - BSA Free

• Alpha-catenin-related protein
• cancer/testis antigen 114
• CAPRrelated
• catenin (cadherin-associated protein), alpha 2
• catenin alpha-2
• CTNR
• DKFZp686H02198

Background

It has been shown that alpha N-catenin, a linker between cadherin adhesion receptors and the actin cytoskeleton, is essential for stabilizing dendritic spines in rodent hippocampal neurons in culture. Results suggest that alpha N-catenin is a key regulator for the stability of synaptic contacts (1). We show here that antibodies against alpha catenin also immunoprecipitate complexes that contain human N-cadherin, mouse P-cadherin, chicken A-CAM (adherens junction-specific CAM; also called N-cadherin) or Xenopus U-cadherin, demonstrating that alpha catenin is complexed with other cadherins(2).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CTNNA2