Catenin alpha 1 Antibody (4G6) Summary
Immunogen |
CTNNA1 (NP_001894, 152 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VQLKVVEDGILKLRNAGNEQDLGIQYKALKPEVDKLNIMAAKRQQELKDVGHRDQMAAARGILQKNVPILYTASQACLQHPDVAAYKANRDLIYKQLQQ |
Specificity |
CTNNA1 - catenin (cadherin-associated protein), alpha 1, 102kDa (4G6) |
Isotype |
IgG1 Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
CTNNA1 |
Purity |
IgG purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Proximity Ligation Assay
- Sandwich ELISA
- Western Blot 1:500
|
Application Notes |
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
IgG purified |
Notes
Quality control test: Antibody Reactive Against Recombinant Protein.
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Catenin alpha 1 Antibody (4G6)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Ch, Av-Du, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Ch, Av-Du, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Am, Bv, Ca, Ch, Hu, Mu, Rt, Tr
Applications: ICC/IF, IHC, IHC-Fr, Simple Western, Single-Cell Western, WB
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Mu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: BA
Species: Hu
Applications: WB, ELISA, PLA, S-ELISA
Publications for Catenin alpha 1 Antibody (H00001495-M03) (0)
There are no publications for Catenin alpha 1 Antibody (H00001495-M03).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Catenin alpha 1 Antibody (H00001495-M03) (0)
There are no reviews for Catenin alpha 1 Antibody (H00001495-M03).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Catenin alpha 1 Antibody (H00001495-M03) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Catenin alpha 1 Products
Bioinformatics Tool for Catenin alpha 1 Antibody (H00001495-M03)
Discover related pathways, diseases and genes to Catenin alpha 1 Antibody (H00001495-M03). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for Catenin alpha 1 Antibody (H00001495-M03)
Discover more about diseases related to Catenin alpha 1 Antibody (H00001495-M03).
| | Pathways for Catenin alpha 1 Antibody (H00001495-M03)
View related products by pathway.
|
PTMs for Catenin alpha 1 Antibody (H00001495-M03)
Learn more about PTMs related to Catenin alpha 1 Antibody (H00001495-M03).
| | Research Areas for Catenin alpha 1 Antibody (H00001495-M03)
Find related products by research area.
|
Blogs on Catenin alpha 1