New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

Catenin alpha 1 Antibody (4G6)

Images

 
Proximity Ligation Assay: Catenin alpha 1 Antibody (4G6) [H00001495-M03] - Analysis of protein-protein interactions between ARRB2 and CTNNA1. HeLa cells were stained with anti-ARRB2 rabbit purified polyclonal 1:1200 and ...read more
Sandwich ELISA: Catenin alpha 1 Antibody (4G6) [H00001495-M03] - Detection limit for recombinant GST tagged CTNNA1 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PLA, S-ELISA
Clone
4G6
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Catenin alpha 1 Antibody (4G6) Summary

Immunogen
CTNNA1 (NP_001894, 152 a.a. ~ 250 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VQLKVVEDGILKLRNAGNEQDLGIQYKALKPEVDKLNIMAAKRQQELKDVGHRDQMAAARGILQKNVPILYTASQACLQHPDVAAYKANRDLIYKQLQQ
Specificity
CTNNA1 - catenin (cadherin-associated protein), alpha 1, 102kDa (4G6)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CTNNA1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Proximity Ligation Assay
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Catenin alpha 1 Antibody (4G6)

  • Alpha E-catenin
  • alpha-catenin
  • alpha-E-catenin
  • alphaE-catenin
  • cadherin-associated protein
  • CAP102
  • catenin (cadherin-associated protein), alpha 1 (102kD)
  • catenin (cadherin-associated protein), alpha 1, 102kDa
  • catenin alpha-1
  • FLJ36832
  • FLJ52416
  • Renal carcinoma antigen NY-REN-13

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF748
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP1-54467
Species: Ch, Av-Du, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP1-54467
Species: Ch, Av-Du, Hu, Mu, Pm, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP2-45646
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-66858
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-48309
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NB100-91662
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB600-1293
Species: Am, Bv, Ca, Ch, Hu, Mu, Rt, Tr
Applications: ICC/IF, IHC, IHC-Fr, Simple Western, Single-Cell Western, WB
NBP1-85047
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
AF1002
Species: Mu
Applications: IHC, Simple Western, WB
NBP2-66987
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-92192
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP3-16628
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB100-79781
Species: Hu
Applications: IHC, IHC-P, IP, WB
NBP2-14119
Species: Hu
Applications: IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
7268-CT
Species: Hu
Applications: BA
H00001495-M03
Species: Hu
Applications: WB, ELISA, PLA, S-ELISA

Publications for Catenin alpha 1 Antibody (H00001495-M03) (0)

There are no publications for Catenin alpha 1 Antibody (H00001495-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Catenin alpha 1 Antibody (H00001495-M03) (0)

There are no reviews for Catenin alpha 1 Antibody (H00001495-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Catenin alpha 1 Antibody (H00001495-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Catenin alpha 1 Products

Bioinformatics Tool for Catenin alpha 1 Antibody (H00001495-M03)

Discover related pathways, diseases and genes to Catenin alpha 1 Antibody (H00001495-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Catenin alpha 1 Antibody (H00001495-M03)

Discover more about diseases related to Catenin alpha 1 Antibody (H00001495-M03).
 

Pathways for Catenin alpha 1 Antibody (H00001495-M03)

View related products by pathway.

PTMs for Catenin alpha 1 Antibody (H00001495-M03)

Learn more about PTMs related to Catenin alpha 1 Antibody (H00001495-M03).
 

Research Areas for Catenin alpha 1 Antibody (H00001495-M03)

Find related products by research area.

Blogs on Catenin alpha 1

There are no specific blogs for Catenin alpha 1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Catenin alpha 1 Antibody (4G6) and receive a gift card or discount.

Bioinformatics

Gene Symbol CTNNA1
Entrez
Uniprot