Recombinant Human Caspase 5 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human Caspase 5 Protein [H00000838-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related Caspase 5 Peptides and Proteins

Order Details


    • Catalog Number
      H00000838-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Caspase 5 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 309-418 of Human Caspase 5

Source: Wheat Germ (in vitro)

Amino Acid Sequence: VRDSPASLAVISSQSSENLEADSVCKIHEEKDFIAFCSSTPHNVSWRDRTRGSIFITELITCFQKYSCCCHLMEIFRKVQKSFEVPQAKAQMPTIERATLTRDFYLFPGN

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
CASP5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
37.84 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Caspase 5 GST (N-Term) Protein

  • CASP5
  • CASP-5
  • caspase 5, apoptosis-related cysteine peptidase
  • caspase 5, apoptosis-related cysteine protease
  • Caspase5
  • Caspase-5
  • EC 3.4.22
  • EC 3.4.22.58
  • ICE(rel)III
  • ICE(rel)-III
  • ICEREL-III
  • ICH3
  • ICH-3
  • MGC141966
  • Protease ICH-3
  • Protease TY
  • TY protease

Background

CASP5 - caspase 5, apoptosis-related cysteine protease

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56565
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NB120-10454
Species: Bv, Hu, Mu, Rt
Applications: ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, MiAr, WB
H00001523-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP1-94105
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-1002
Species: Hu
Applications: ICC/IF, PEP-ELISA, WB
AF820
Species: Hu, Mu
Applications: ICC, IHC, KO, Simple Western, WB
NB100-56116
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP3-24587
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-56114
Species: Ca, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
AF4117
Species: Rt
Applications: IHC, WB
NBP1-78977
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IM, IP, Simple Western, WB
NBP2-12446
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IM, IP, KD, WB
NBP1-54899
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
NBP1-83319
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-56118
Species: Ca, Ma, Hu, Mu, Rt
Applications: Flow-IC, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB100-56529
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB

Publications for Caspase 5 Partial Recombinant Protein (H00000838-Q01) (0)

There are no publications for Caspase 5 Partial Recombinant Protein (H00000838-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Caspase 5 Partial Recombinant Protein (H00000838-Q01) (0)

There are no reviews for Caspase 5 Partial Recombinant Protein (H00000838-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Caspase 5 Partial Recombinant Protein (H00000838-Q01). (Showing 1 - 1 of 1 FAQ).

  1. Can you provide me with H00000838-Q01(Caspase 5 Partial Recombinant Protein 25 ug), but without the GST tag? This is to be used in an ELISA.
    • We unfortunately do not provide H00000838-Q01 without the GST tag at this time. We can request custom formulations if a bulk amount is ordered. Otherwise, we do have a protocol for removing the GST tag from the protein

Additional Caspase 5 Products

Research Areas for Caspase 5 Partial Recombinant Protein (H00000838-Q01)

Find related products by research area.

Blogs on Caspase 5.

CARD & NFKB Antibodies for Apoptosis Research
Apoptosis is one of the main types of programmed cell death which involves a cascade of biochemical events leading to specific cell morphology characteristics and ultimately death of cells.Caspases play crucial roles in modulating cellular signaling...  Read full blog post.

Caspase Antibodies as Cancer Biomarkers
We at Novus Biologicals are one of the leading antibody suppliers for products targeted to apoptosis. These products are regularly used by cancer research groups - apoptosis is fundamental to developing therapies that will kill tumor cells. Caspase pr...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Caspase 5 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CASP5