Caspase-1 Recombinant Protein Antigen

Images

 
There are currently no images for Caspase-1 Protein (NBP1-87680PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Caspase-1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CASP1.

Source: E.coli

Amino Acid Sequence: PDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVGVSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEYACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CASP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-87680.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
35 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Caspase-1 Recombinant Protein Antigen

  • CASP1
  • CASP-1
  • caspase 1, apoptosis-related cysteine peptidase (interleukin 1, beta
  • caspase 1, apoptosis-related cysteine protease (interleukin 1, beta
  • Caspase1
  • Caspase-1
  • EC 3.4.22
  • EC 3.4.22.36
  • ICE
  • ICEP45
  • IL-1 beta-converting enzyme
  • IL1BC CASP1 nirs variant 1
  • IL-1BC
  • IL1BCE
  • IL1B-convertase
  • interleukin 1-B converting enzyme
  • interleukin 1-beta convertase
  • Interleukin-1 beta convertase
  • Interleukin-1 beta-converting enzyme
  • p45

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12446
Species: Hu, Mu, Rt, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78977
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB120-13550
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56116
Species: Hu, Mu, Rt, Ge
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
7270-IL/CF
Species: Hu
AF800
Species: Hu, Mu
Applications: WB, Simple Western, IP
NB100-56142
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-56118
Species: Hu, Mu, Rt, Ca, Ge
Applications: IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-67333
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for Caspase-1 Protein (NBP1-87680PEP) (0)

There are no publications for Caspase-1 Protein (NBP1-87680PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Caspase-1 Protein (NBP1-87680PEP) (0)

There are no reviews for Caspase-1 Protein (NBP1-87680PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for Caspase-1 Protein (NBP1-87680PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Caspase-1 Protein (NBP1-87680PEP)

Discover related pathways, diseases and genes to Caspase-1 Protein (NBP1-87680PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Caspase-1 Protein (NBP1-87680PEP)

Discover more about diseases related to Caspase-1 Protein (NBP1-87680PEP).
 

Pathways for Caspase-1 Protein (NBP1-87680PEP)

View related products by pathway.

PTMs for Caspase-1 Protein (NBP1-87680PEP)

Learn more about PTMs related to Caspase-1 Protein (NBP1-87680PEP).
 

Research Areas for Caspase-1 Protein (NBP1-87680PEP)

Find related products by research area.

Blogs on Caspase-1.

The inflammasome: an inflammation-initiating machine, Novus Biologicals
By Stephanie Melchor The inflammasome is a large, multimeric protein complex found primarily in innate immune cells, which are white blood cells that can attack a wide range of pathogenic threats. Three main elements...  Read full blog post.

NLRP3/NALP3 - Sensing and responding to pathogen infection
The inflammasome is a multi protein complex that is an important component of the innate immune response. The inflammasome is able to sense and respond to pathogen infections by recognizing pathogen-associated molecular patterns and mediating the ...  Read full blog post.

Caspase 10 - an initiator caspase in the extrinsic death receptor pathway
Apoptosis, also called programmed cell death, is an essential process in development and disease. The signaling networks that carry out apoptosis is consists of a series of endoproteases called caspases which are synthesized as inactive zymogens....  Read full blog post.

Caspase 7 - A key effector of the apoptotic pathway
Caspase-7 is an effector caspase with important roles in mediating cell death signaling. As an effector caspase, caspase-7 is cleaved and activated by initiator caspases such as caspase-1 (1). Like other caspase family proteins, caspase-7 contains a...  Read full blog post.

Caspase 1 - activating innate immune responses following infection or injury
Caspase-1 is an enzyme involved in the conversion of interleukin-1 into its active secreted form. Interleukin-1 mediates inflammatory responses during infection and disease. Caspase-1 is recruited to and activated by the inflammasome complex (1). Un...  Read full blog post.

Caspase-4 - a human protease with roles in inflammation and immunity
Caspases are a family of cysteine-aspartic acid proteases that cleave caspase proenzymes as well as other protein substrates. Caspases are well known for their role in apoptosis, but they also play a significant role in other cellular processes inc...  Read full blog post.

Customers Who Bought This Also Bought

IL-6 [Unconjugated]
7270-IL-025/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Caspase-1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CASP1