Recombinant Human Caspase-1 GST (N-Term) Protein

Images

 
SDS-Page: Recombinant Human Caspase-1 Protein [H00000834-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human Caspase-1 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-100 of Human Caspase-1

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MADKVLKEKRKLFIRSMGEAPQAVQDNPAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRTGAEVDITGMTMLL

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
CASP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.63 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Caspase-1 GST (N-Term) Protein

  • CASP1 nirs variant 1
  • CASP1
  • CASP-1
  • caspase 1, apoptosis-related cysteine peptidase
  • Caspase-1 subunit p10
  • Caspase-1 subunit p20
  • Caspase1
  • Caspase-1
  • EC 3.4.22.36
  • EC:3.4.22.36
  • ICE
  • IL-1 beta-converting enzyme
  • IL1BC
  • IL-1BC
  • IL1BCE
  • IL1B-convertase
  • interleukin 1, beta, convertase
  • interleukin 1-B converting enzyme
  • Interleukin-1 beta convertase
  • Interleukin-1 beta-converting enzyme
  • p45

Background

Caspase-1, also known as interleukin-1-beta (IL-1beta) -converting enzyme (ICE), is a member of the cysteine-aspartic protease (caspase) family (1). The caspase family are aspartic proteolytic enzymes that play a key role in apoptotic cell death and inflammation (1). Caspase-1 is synthesized as an inactive proenzyme with a theoretical molecular weight of approximately 45 kDa and is 404 amino acids (aa) in length. The caspase-1 protein structure contains an N-terminal CARD (caspase recruitment domain), a large 20kDa P20 subunit (aa 120-297), and a small 10kDa P10 subunit (aa 317-404) (1, 2). The proenzyme undergoes cleavage at aspartic acid (Asp) residues to produce the active caspase-1 enzyme which exists as a heterotetramer (homodimer of the P20 and P10 heterodimers) (2). Inflammasome complexes sense various microbial and endogenous signals, including ligand-receptor interaction and growth factor deprivation, which results in the processing of pro-caspase to active caspase-1 (3, 4).The active caspase-1 is responsible for the cleavage and maturation of pro-inflammatory cytokines IL-1beta and IL-18, and promotes an inflammatory form of cell death induced by bacterial pathogens called pyroptosis (3, 4). Mature IL-1beta has a role in the immune reaction and recruiting inflammatory cells to the site of infection while IL-18 plays a role in interferon-gamma production and promotes cytolytic activity in natural killer cells (4).

Given the role of IL-1beta in inflammation, it makes sense that many diseases and pathologies have been associated with dysregulation of caspase-1 activation and the inflammasome (3, 4). The inflammasome is a multiprotein complex comprised of Nod-like receptor (NLR) family members and the adapter ASC (apoptosis-associated speck-like protein containing a CARD) which are crucial for capase-1 activation (3-5). For instance, the neuronal apoptosis inhibitory protein (NAIP)/NLRC4 inflammasome has been associated with colorectal cancer, breast cancer, and glioma pathogenesis (5). Caspase-1 activation and mutations in the inflammasome have also been linked to Chron's disease and Alzheimer's disease (4). In addition to immune and inflammatory related disorder, the inflammasome has been linked to metabolic and obesity related disorders including diabetes and cardiovascular disease (6). Finally, caspase-1 deficient mice exhibit enhanced epithelial cell proliferation in the colon, increased tumor formation, and reduced apoptosis (1). A more thorough understanding of the inflammasome-caspase-1 signaling pathway will be important for understanding disease pathology and potential therapeutic development.

Alternative names for caspase-1 includes CASP1, CASP1 nirs variant 1, EC 3.4.22.36, ICE, IL-1 beta-converting enzyme, IL1BC, IL1BCE, IL1B-converstase, interleukin-1 beta convertase, and p45.

References

1. Shalini, S., Dorstyn, L., Dawar, S., & Kumar, S. (2015). Old, new and emerging functions of caspases. Cell death and differentiation. https://doi.org/10.1038/cdd.2014.216

2. Chang, H. Y., & Yang, X. (2000). Proteases for cell suicide: functions and regulation of caspases. Microbiology and molecular biology reviews: MMBR. https://doi.org/10.1128/mmbr.64.4.821-846.2000

3. Vanaja, S. K., Rathinam, V. A., & Fitzgerald, K. A. (2015). Mechanisms of inflammasome activation: recent advances and novel insights. Trends in cell biology. https://doi.org/10.1016/j.tcb.2014.12.009

4. Franchi, L., Eigenbrod, T., Munoz-Planillo, R., & Nunez, G. (2009). The inflammasome: a caspase-1-activation platform that regulates immune responses and disease pathogenesis. Nature immunology. https://doi.org/10.1038/ni.1703

5. Kay, C., Wang, R., Kirkby, M., & Man, S. M. (2020). Molecular mechanisms activating the NAIP-NLRC4 inflammasome: Implications in infectious disease, autoinflammation, and cancer. Immunological reviews. https://doi.org/10.1111/imr.12906

6. Pham, D., Park, P. (2020). Recent insights on modulation of inflammasomes by adipokines: a critical event for the pathogenesis of obesity and metabolism-associated diseases. Archives of Pharmacal Research. https://doi.org/10.1007/s12272-020-01274-7

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

7625
Species: Mu
Applications: ELISA
NBP2-12446
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IM, IP, KD, WB
201-LB
Species: Hu
Applications: BA
NBP1-78977
Species: Hu, Mu, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC,  IHC-P, IM, IP, Simple Western, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
7398-FS
Species: Hu
Applications: BA
NB100-56116
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NB100-56599
Species: Hu, Mu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, WB
NBP1-90095
Species: Hu
Applications: IHC,  IHC-P
M6000B
Species: Mu
Applications: ELISA
AF800
Species: Hu, Mu
Applications: IP, Simple Western, WB
NBP1-78979
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC,  IHC-P
485-MI
Species: Mu
Applications: BA
NB100-56118
Species: Ca, Ma, Hu, Mu, Rt
Applications: Flow-IC, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
702-C2/CF
Species: Hu
Applications: EnzAct
H00000834-Q01
Species: Hu
Applications: WB, ELISA, MA, AP

Publications for Caspase-1 Partial Recombinant Protein (H00000834-Q01) (0)

There are no publications for Caspase-1 Partial Recombinant Protein (H00000834-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Caspase-1 Partial Recombinant Protein (H00000834-Q01) (0)

There are no reviews for Caspase-1 Partial Recombinant Protein (H00000834-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Caspase-1 Partial Recombinant Protein (H00000834-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Caspase-1 Products

Research Areas for Caspase-1 Partial Recombinant Protein (H00000834-Q01)

Find related products by research area.

Blogs on Caspase-1.

The NLRP3 Inflammasome: Macrophage Activator & Pathology Driver
By Victoria Osinski, PhDWhat is the NLRP3 Inflammasome?With its critical role in innate immunity, the nucleotide-binding oligomerization domain-like receptor family, pyrin domain containing 3 (NLRP3) inflammasome ...  Read full blog post.

Pyroptosis: Mechanisms mediating cell death and pro-inflammatory cytokine release
By Victoria OsinskiPyroptosis is an inflammatory form of programmed cell death characterized by the release of pro-inflammatory cytokines IL-1 beta and IL-18.1,10 It is a process distinct from apoptosis and necrosis (T...  Read full blog post.

The inflammasome: an inflammation-initiating machine, Novus Biologicals
By Stephanie Melchor The inflammasome is a large, multimeric protein complex found primarily in innate immune cells, which are white blood cells that can attack a wide range of pathogenic threats. Three main elements ...  Read full blog post.

NLRP3/NALP3 - Sensing and responding to pathogen infection
The inflammasome is a multi protein complex that is an important component of the innate immune response. The inflammasome is able to sense and respond to pathogen infections by recognizing pathogen-associated molecular patterns and mediating the ...  Read full blog post.

Caspase 10 - an initiator caspase in the extrinsic death receptor pathway
Apoptosis, also called programmed cell death, is an essential process in development and disease. The signaling networks that carry out apoptosis is consists of a series of endoproteases called caspases which are synthesized as inactive zymogens. ...  Read full blog post.

Caspase 7 - A key effector of the apoptotic pathway
Caspase-7 is an effector caspase with important roles in mediating cell death signaling. As an effector caspase, caspase-7 is cleaved and activated by initiator caspases such as caspase-1 (1). Like other caspase family proteins, caspase-7 contains a...  Read full blog post.

Caspase 1 - activating innate immune responses following infection or injury
Caspase-1 is an enzyme involved in the conversion of interleukin-1 into its active secreted form. Interleukin-1 mediates inflammatory responses during infection and disease. Caspase-1 is recruited to and activated by the inflammasome complex (1). Un...  Read full blog post.

Caspase-4 - a human protease with roles in inflammation and immunity
Caspases are a family of cysteine-aspartic acid proteases that cleave caspase proenzymes as well as other protein substrates. Caspases are well known for their role in apoptosis, but they also play a significant role in other cellular processes inc...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Caspase-1 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CASP1