Casein Kinase 1 epsilon Antibody - BSA Free Summary
| Description |
Novus Biologicals Knockout (KO) Validated Rabbit Casein Kinase 1 epsilon Antibody - BSA Free (NBP2-92968) is a polyclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 247-416 of human Casein Kinase 1 epsilon (NP_689407.1). EFSTYLNFCRSLRFDDKPDYSYLRQLFRNLFHRQGFSYDYVFDWNMLKFGAARNPEDVDRERREHEREERMGQLRGSATRALPPGPPTGATANRLRSAAEPVASTPASRIQPAGNTSPRAISRVDRERKVSMRLHRGAPANVSSSDLTGRQEVSRIPASQTSVPFDHLGK |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CSNK1E |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
- Immunocytochemistry/ Immunofluorescence 1:50-1:200
- Immunohistochemistry 1:50-1:200
- Immunohistochemistry-Paraffin
- Knockout Validated
- Western Blot 1:500-1:2000
|
| Theoretical MW |
47 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.09% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Casein Kinase 1 epsilon Antibody - BSA Free
Background
CKI epsilon is a member of the casein kinase 1 (CK1) serine/threonine kinase family of proteins. In mammals, there are seven distinct genes that represent the CK1 family: alpha, beta, gamma-1, gamma-2, gamma-3, delta, and epsilon. CKI epsilon phosphorylates a large number of proteins and is involved in pathways involving Wnt and AKT. CKI epsilon has been found to bind and phosphorylate the circadian protein, Period, and the Wnt signaling protein, Dsh. In the Wnt pathway, CKI epsilon activity is required for the full activation of Dsh and downstream signaling effects.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: IB, IHC, IHC-P, KO, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu, Mu, Rt
Applications: DB, ELISA, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Mu, Rt
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Bv, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, PLA, WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu, Mu
Applications: ChIP, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, KO
Publications for Casein Kinase 1 epsilon Antibody (NBP2-92968) (0)
There are no publications for Casein Kinase 1 epsilon Antibody (NBP2-92968).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Casein Kinase 1 epsilon Antibody (NBP2-92968) (0)
There are no reviews for Casein Kinase 1 epsilon Antibody (NBP2-92968).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Casein Kinase 1 epsilon Antibody (NBP2-92968) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Casein Kinase 1 epsilon Products
Research Areas for Casein Kinase 1 epsilon Antibody (NBP2-92968)
Find related products by research area.
|
Blogs on Casein Kinase 1 epsilon