Casein Kinase 1 epsilon Antibody

Images

 
Western Blot: Casein Kinase 1 epsilon Antibody [NBP1-89712] - Analysis in human cell line SCLC-21H.
Immunohistochemistry-Paraffin: Casein Kinase 1 epsilon Antibody [NBP1-89712] - Staining of human stomach shows strong cytoplasmic and membrane positivity in glandular cells.
Western Blot: Casein Kinase 1 epsilon Antibody [NBP1-89712] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Casein Kinase 1 epsilon Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NMLKFGAARNPEDVDRERREHEREERMGQLRGSATRALPPGPPTGATANRLRSAAEPVASTPASRIQPAGNTSP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CSNK1E
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Casein Kinase 1 epsilon Protein (NBP1-89712PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Casein Kinase 1 epsilon Antibody

  • Casein Kinase 1 epsilon
  • casein kinase 1, epsilon
  • casein kinase I isoform epsilon
  • CKIe
  • CKI-epsilon
  • CSNK1E
  • EC 2.7.11
  • EC 2.7.11.1
  • HCKIE
  • MGC10398

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-125
Species: Hu
Applications: WB, ICC/IF
NBP2-24589
Species: Hu, Mu, Rt, Bv, Eq, Pm
Applications: WB, IHC-P
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-21376
Species: Hu
Applications: WB, IP
NBP1-86692
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
AF3287
Species: Hu, Mu, Rt
Applications: WB
NB100-2288
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P
H00008863-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-00749
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006934-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-33534
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25162
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
AF3764
Species: Hu, Mu
Applications: WB, IHC, ICC
NB100-126
Species: Hu, Mu
Applications: WB, ChIP
H00149420-P01
Species: Hu

Publications for Casein Kinase 1 epsilon Antibody (NBP1-89712) (0)

There are no publications for Casein Kinase 1 epsilon Antibody (NBP1-89712).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Casein Kinase 1 epsilon Antibody (NBP1-89712) (0)

There are no reviews for Casein Kinase 1 epsilon Antibody (NBP1-89712). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Casein Kinase 1 epsilon Antibody (NBP1-89712) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Casein Kinase 1 epsilon Products

Bioinformatics Tool for Casein Kinase 1 epsilon Antibody (NBP1-89712)

Discover related pathways, diseases and genes to Casein Kinase 1 epsilon Antibody (NBP1-89712). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Casein Kinase 1 epsilon Antibody (NBP1-89712)

Discover more about diseases related to Casein Kinase 1 epsilon Antibody (NBP1-89712).
 

Pathways for Casein Kinase 1 epsilon Antibody (NBP1-89712)

View related products by pathway.

PTMs for Casein Kinase 1 epsilon Antibody (NBP1-89712)

Learn more about PTMs related to Casein Kinase 1 epsilon Antibody (NBP1-89712).
 

Research Areas for Casein Kinase 1 epsilon Antibody (NBP1-89712)

Find related products by research area.

Blogs on Casein Kinase 1 epsilon

There are no specific blogs for Casein Kinase 1 epsilon, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Casein Kinase 1 epsilon Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CSNK1E
Entrez