Casein Kinase 1 epsilon Antibody - BSA Free

Analysis in human cell line SCLC-21H.

• Reactivity: Hu, Mu, Rt
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Casein Kinase 1 epsilon Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NMLKFGAARNPEDVDRERREHEREERMGQLRGSATRALPPGPPTGATANRLRSAAEPVASTPASRIQPAGNTSP
• Predicted Species: Rat (99%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CSNK1E
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 0.04-0.4 ug/ml
• Control Peptide:

  Casein Kinase 1 epsilon Protein (NBP1-89712PEP)

Reactivity Notes

Reactivity in Mouse reported in the scientific literature (PMID:29118923)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Casein Kinase 1 epsilon Antibody - BSA Free

• Casein Kinase 1 epsilon
• casein kinase 1, epsilon
• casein kinase I isoform epsilon
• CKIe
• CKI-epsilon
• CSNK1E
• EC 2.7.11
• EC 2.7.11.1
• HCKIE
• MGC10398

Background

CKI epsilon is a member of the casein kinase 1 (CK1) serine/threonine kinase family of proteins. In mammals, there are seven distinct genes that represent the CK1 family: alpha, beta, gamma-1, gamma-2, gamma-3, delta, and epsilon. CKI epsilon phosphorylates a large number of proteins and is involved in pathways involving Wnt and AKT. CKI epsilon has been found to bind and phosphorylate the circadian protein, Period, and the Wnt signaling protein, Dsh. In the Wnt pathway, CKI epsilon activity is required for the full activation of Dsh and downstream signaling effects.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Casein Kinase 1 epsilon Antibody (NBP1-89712)(1)

Publication using NBP1-89712

• Chen Y, Wang Q, Wang Q et al. DDX3 binding with CK1 epsilon was closely related to motor neuron degeneration of ALS by affecting neurite outgrowth Am J Transl Res 2017-10-15 [PMID: 29118923] (WB, Mouse)

Bioinformatics

• Gene Symbol: CSNK1E