Recombinant Human CART1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CART1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 198-306 of Human CART1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:QAKSHFAATYDISVLPRTDSYPQIQNNLWAGNASGGSVVTSCMLPRDTSSCMTPYSHSPRTDSSYTGFSNHQNQFSHVPLNNFFTDSLLTGATNGHAFETKPEFERRSS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
ALX1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CART1 Protein

  • ALX homeobox 1
  • CART-1
  • CART1ALX homeobox protein 1
  • Cartilage homeoprotein 1
  • cartilage paired-class homeoprotein 1
  • FND3

Background

CART1 - cartilage paired-class homeoprotein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45490
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NBP1-80285
Species: Mu
Applications: WB
NB100-381
Species: Hu
Applications: WB, ChIP, IP, PLA
NBP2-22169
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB500-487
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
H00005956-R02
Species: Hu
NB100-136
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
NBP1-76729
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56177
Species: Hu, Mu, Rt, Bv, Ze
Applications: WB, IHC, IHC-P, IP
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74350
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-01833
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2420
Species: Hu
Applications: WB, IHC
AF2050
Species: Hu
Applications: WB, IHC
NBP2-13816
Species: Hu
Applications: WB, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-82558
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB2457
Species: Hu, Mu
Applications: WB, CyTOF-ready, ICC, ICFlow

Publications for CART1 Partial Recombinant Protein (H00008092-Q01) (0)

There are no publications for CART1 Partial Recombinant Protein (H00008092-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CART1 Partial Recombinant Protein (H00008092-Q01) (0)

There are no reviews for CART1 Partial Recombinant Protein (H00008092-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CART1 Partial Recombinant Protein (H00008092-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CART1 Products

Bioinformatics Tool for CART1 Partial Recombinant Protein (H00008092-Q01)

Discover related pathways, diseases and genes to CART1 Partial Recombinant Protein (H00008092-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CART1 Partial Recombinant Protein (H00008092-Q01)

Discover more about diseases related to CART1 Partial Recombinant Protein (H00008092-Q01).
 

Pathways for CART1 Partial Recombinant Protein (H00008092-Q01)

View related products by pathway.

PTMs for CART1 Partial Recombinant Protein (H00008092-Q01)

Learn more about PTMs related to CART1 Partial Recombinant Protein (H00008092-Q01).

Blogs on CART1

There are no specific blogs for CART1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CART1 Antibody (2A10)
H00008092-M02

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CART1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ALX1