Carboxylesterase 1/CES1 Recombinant Protein Antigen

Images

 
There are currently no images for Carboxylesterase 1/CES1 Recombinant Protein Antigen (NBP1-85691PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Carboxylesterase 1/CES1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CES1.

Source: E.coli

Amino Acid Sequence: VTIFGESAGGESVSVLVLSPLAKNLFHRAISESGVALTSVLVKKGDVKPLAEQIAITAGCKTTTSAVMVHCLRQKTEEELLETTLKMKFLSLDLQGDPRESQPLLGTVIDGMLLLKTPEELQAERNFHTVP

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CES1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-85691.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for Carboxylesterase 1/CES1 Recombinant Protein Antigen

  • ACAT
  • acyl coenzyme A:cholesterol acyltransferase
  • Acyl-coenzyme A:cholesterol acyltransferase
  • Brain carboxylesterase hBr1
  • carboxylesterase 1 (monocyte/macrophage serine esterase 1)
  • Carboxylesterase 1
  • carboxylesterase 2 (liver)
  • CEH
  • CES1
  • Ces-1
  • CES1A2
  • CES2EC 3.1.1.1
  • cholesteryl ester hydrolase
  • Cocaine carboxylesterase
  • EC 3.1.1
  • Egasyn
  • HMSE1
  • HMSECES1A1
  • human monocyte/macrophage serine esterase 1
  • liver carboxylesterase 1
  • MGC117365
  • Monocyte/macrophage serine esterase
  • PCE-1
  • REH
  • Retinyl ester hydrolase
  • Serine esterase 1
  • SES1
  • Ses-1
  • SES1TGH
  • TGH
  • Triacylglycerol hydrolase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88502
Species: Hu
Applications: IHC, IHC-P
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
NBP2-45981
Species: Hu
Applications: IHC
NBP1-91996
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, RIA
NB110-37253
Species: Hu, Mu, Rt
Applications: WB
NBP1-89284
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB9120
Species: Hu
Applications: ICC
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
NBP2-02588
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-52979
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF5985
Species: Mu, Rt
Applications: WB, IP
NB400-107
Species: Hu, Mu
Applications: WB, ELISA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-85691PEP
Species: Hu
Applications: AC

Publications for Carboxylesterase 1/CES1 Recombinant Protein Antigen (NBP1-85691PEP) (0)

There are no publications for Carboxylesterase 1/CES1 Recombinant Protein Antigen (NBP1-85691PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Carboxylesterase 1/CES1 Recombinant Protein Antigen (NBP1-85691PEP) (0)

There are no reviews for Carboxylesterase 1/CES1 Recombinant Protein Antigen (NBP1-85691PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Carboxylesterase 1/CES1 Recombinant Protein Antigen (NBP1-85691PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional Carboxylesterase 1/CES1 Products

Bioinformatics Tool for Carboxylesterase 1/CES1 Recombinant Protein Antigen (NBP1-85691PEP)

Discover related pathways, diseases and genes to Carboxylesterase 1/CES1 Recombinant Protein Antigen (NBP1-85691PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Carboxylesterase 1/CES1 Recombinant Protein Antigen (NBP1-85691PEP)

Discover more about diseases related to Carboxylesterase 1/CES1 Recombinant Protein Antigen (NBP1-85691PEP).
 

Pathways for Carboxylesterase 1/CES1 Recombinant Protein Antigen (NBP1-85691PEP)

View related products by pathway.

PTMs for Carboxylesterase 1/CES1 Recombinant Protein Antigen (NBP1-85691PEP)

Learn more about PTMs related to Carboxylesterase 1/CES1 Recombinant Protein Antigen (NBP1-85691PEP).

Blogs on Carboxylesterase 1/CES1

There are no specific blogs for Carboxylesterase 1/CES1, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought


Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Carboxylesterase 1/CES1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CES1