Carboxyl Ester Lipase/CEL Antibody

Images

 
Western Blot: Carboxyl Ester Lipase/CEL Antibody [NBP1-57922] - SH-SYSY cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Carboxyl Ester Lipase/CEL Antibody Summary

Immunogen
Synthetic peptides corresponding to CEL(carboxyl ester lipase (bile salt-stimulated lipase)) The peptide sequence was selected from the middle region of CEL. Peptide sequence VTPTGDSETAPVPPTGDSGAPPVPPTGDSEAAPVPPTDDSKEAQMPAVIR.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CEL
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CEL and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Carboxyl Ester Lipase/CEL Antibody

  • BAL
  • bile salt-activated lipase
  • Bile salt-stimulated lipase
  • BSDL
  • BSSL
  • BSSLbile salt-dependent lipase, oncofetal isoform
  • bucelipase
  • carboxyl ester hydrolase
  • carboxyl ester lipase (bile salt-stimulated lipase)
  • Carboxyl Ester Lipase
  • CEase
  • CEL
  • CELL
  • Cholesterol esterase
  • EC 3.1.1
  • EC 3.1.1.13
  • EC 3.1.1.3
  • FAP
  • FAPP
  • fetoacinar pancreatic protein
  • LIPA
  • lysophospholipase, pancreatic
  • MODY8bile-salt-activated lipase
  • Pancreatic lysophospholipase
  • Sterol esterase

Background

CEL catalyzes fat and vitamin absorption. CEL acts in concert with pancreatic lipase and colipase for the complete digestion of dietary triglycerides.The protein encoded by this gene is a glycoprotein secreted from the pancreas into the digestive tract and from the lactating mammary gland into human milk. The physiological role of this protein is in cholesterol and lipid-soluble vitamin ester hydrolysis and absorption. This encoded protein promotes large chylomicron production in the intestine. Also its presence in plasma suggests its interactions with cholesterol and oxidized lipoproteins to modulate the progression of atherosclerosis. In pancreatic tumoral cells, this encoded protein is thought to be sequestrated within the Golgi compartment and is probably not secreted. This gene contains a variable number of tandem repeat (VNTR) polymorphism in the coding region that may influence the function of the encoded protein. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-37253
Species: Hu, Mu, Rt
Applications: WB
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85691
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
AF7197
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB110-41536
Species: Hu, Mu
Applications: WB, ICC/IF
AF1180
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
NBP2-02948
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89285
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP1-57922
Species: Hu
Applications: WB

Publications for Carboxyl Ester Lipase/CEL Antibody (NBP1-57922) (0)

There are no publications for Carboxyl Ester Lipase/CEL Antibody (NBP1-57922).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Carboxyl Ester Lipase/CEL Antibody (NBP1-57922) (0)

There are no reviews for Carboxyl Ester Lipase/CEL Antibody (NBP1-57922). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Carboxyl Ester Lipase/CEL Antibody (NBP1-57922) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Carboxyl Ester Lipase/CEL Products

Bioinformatics Tool for Carboxyl Ester Lipase/CEL Antibody (NBP1-57922)

Discover related pathways, diseases and genes to Carboxyl Ester Lipase/CEL Antibody (NBP1-57922). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Carboxyl Ester Lipase/CEL Antibody (NBP1-57922)

Discover more about diseases related to Carboxyl Ester Lipase/CEL Antibody (NBP1-57922).
 

Pathways for Carboxyl Ester Lipase/CEL Antibody (NBP1-57922)

View related products by pathway.

PTMs for Carboxyl Ester Lipase/CEL Antibody (NBP1-57922)

Learn more about PTMs related to Carboxyl Ester Lipase/CEL Antibody (NBP1-57922).

Blogs on Carboxyl Ester Lipase/CEL

There are no specific blogs for Carboxyl Ester Lipase/CEL, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Carboxyl Ester Lipase/CEL Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CEL
Entrez