Carbonic Anhydrase VA/CA5A Antibody - BSA Free

Western Blot: Carbonic Anhydrase VA/CA5A Antibody [NBP2-86595] - WB Suggested Anti-CA5A Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:312500. Positive Control: A549 cell lysate

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Carbonic Anhydrase VA/CA5A Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human Carbonic Anhydrase VA/CA5A. Peptide sequence: AVIGVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDY The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: CA5A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Carbonic Anhydrase VA/CA5A Antibody - BSA Free

• CA5A
• CA5carbonic anhydrase 5A, mitochondrial
• Carbonate dehydratase VA
• carbonic anhydrase V, mitochondrial
• Carbonic Anhydrase VA
• carbonic anhydrase VA, mitochondrial
• carbonic dehydratase
• CAV
• CAVA
• CA-VA
• EC 4.2.1.1

Background

Carbonic anhydrases (CAs) are a large family of zinc metalloenzymes that catalyze the reversible hydration of carbon dioxide. They participate in a variety of biological processes, including respiration, calcification, acid-base balance, bone resorption, and the formation of aqueous humor, cerebrospinal fluid, saliva, and gastric acid. They show extensive diversity in tissue distribution and in their subcellular localization. CA VA is localized in the mitochondria and expressed primarily in the liver. It may play an important role in ureagenesis and gluconeogenesis. CA5A gene maps to chromosome 16q24.3 and an unprocessed pseudogene has been assigned to 16p12-p11.2. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CA5A